KEGG   Halorhodospira halochloris: HH1059_02330Help
Entry
HH1059_02330      CDS       T06158                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hhk  Halorhodospira halochloris
Pathway
hhk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hhk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    HH1059_02330 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hhk03400]
    HH1059_02330 (recD)
Enzymes [BR:hhk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HH1059_02330 (recD)
DNA repair and recombination proteins [BR:hhk03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     HH1059_02330 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD SH3_13 AAA_22 AAA_16 UvrD_C DUF2075 AAA_28 UvrD-helicase Mg_chelatase NTPase_1 PIF1 T2SSE
Motif
Other DBs
NCBI-ProteinID: BAU56909
UniProt: A0A0X8X7A4
Position
complement(254009..256066)
Genome map
AA seq 685 aa AA seqDB search
MSAASHPLDSATAALALLKDWRDCDWLRPLDHALVAFLHDQAPGTTPATLLCAALVSHQA
GRGHVCLDLDALLSDPDRSLSLPPEDGRGAEAMTEQPLPRPAQCLSGLDRSTLVATLNAD
SDVVGAPIEASPDADEQPPLILDGHRLYLRRYWQSERRIAVTLERRMAQVTQWRDELEPK
AVRRWLDTLFGPQDPTETWQRLACAVAAGSGFAVVTGGPGTGKTTTVVRLLALLQGLRRD
AEQRPLRIRMAAPTGKAAARLNASVAGTVHGLNLPDEQLRANIPTEVTTIHRLLGVRPGS
RRFRHDADNLLPLDVLVVDEASMIDVELMASTLAALPPRARLILLGDHDQLASVEAGAVL
GELCQRAAQGHYMPTTCDWLESVSGESIPEQLRDTAGSALDQHVVMLRHSHRFAADSGIG
RLANAVNSGDIATAKTLLATGGYTDLHHQHLRGPDDNALEELAEAGYRPYLEAVAARPDA
TATAAEYDEWAHRVLTEHGRFQLLTALRRGPWGVEGLNRRIAARLAASGLIESGAHWYPG
RPVMVTRNDYELGLNNGDIGIALPLPDTDEPHRTTLRVAFPAADGGKAALRWVLPARLNN
IETVFAMTVHKAQGSEFDHAALLLPDRPSPILTRELIYTAITRARNRFTLLDPGHSVLAA
GLAARVNRSAGLHDQLIGMKPPGNL
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgctagccatcccctggacagcgcgacagcggccctcgccctactgaaggac
tggcgcgactgcgattggctgcggcccctcgatcacgccctagtcgccttcctccatgac
caggccccgggtaccaccccagcgaccctgctctgtgctgccctggtcagccatcaggcc
ggacgcggccacgtctgcctcgacctcgatgcactactatccgatcctgatcgcagcctg
tcgctgccaccggaagatggacgcggcgctgaagcaatgacggagcagcccctgccgcgt
cccgcccagtgtctctccggtctcgatcgtagcaccctggtggcgaccctaaacgccgac
agcgacgtggttggcgcgccgatagaggccagccccgacgcagatgaacagccaccgctt
atccttgatggccaccgcctctatctacgccgctattggcagagcgaaaggcgtatcgcc
gtcaccctggagaggcgcatggcacaggtcacgcagtggcgggacgaactggagccaaaa
gcggtgcgccgctggctcgacaccctattcgggccacaggaccccaccgaaacctggcag
cgactagcctgcgcggtggccgctggcagcggcttcgcggtggtcaccggcggccccggc
accggcaagaccactaccgtggtgcgcctgctcgccctgctccaggggctgcgtcgcgat
gccgagcagcgccccttgcgcatccgcatggctgcccccaccggcaaggccgccgcccgc
ttgaacgcctccgttgccggcactgttcacggtctaaacctgcccgacgagcaactccgt
gccaacatacccaccgaggtcaccaccatccaccgacttctgggtgtccggccaggctcg
cgccgctttcgccatgatgccgataacctgctgccgctcgatgtgctggtggtagacgag
gcgtcgatgatagatgtcgaactaatggcatcgaccttggctgccctgccacctcgggct
cggctgatcctactcggcgaccacgaccagctcgcctcggtggaggccggtgccgtgcta
ggggaactctgccagcgcgctgcgcaaggccactatatgcccaccacttgcgactggctg
gagtcggtcagtggcgagagcatccccgagcagctgcgtgataccgctggcagcgccttg
gatcaacacgttgtcatgctccgccacagccaccgcttcgctgctgacagtggcattggt
cgcctggccaacgccgtcaacagcggcgacattgccaccgccaagaccctactggccacc
ggcggctacaccgacctccaccaccagcacctgcgcggccccgatgataacgccctggag
gaactagccgaagccggctaccgcccctatctggaggccgtcgccgcccgccctgatgcc
acagccacggcggccgagtatgacgagtgggcccaccgcgtcctcaccgagcatggacgt
ttccagctgctgaccgccctgcgccgcggcccttggggggtcgaggggctaaataggcgc
atcgctgccaggctagcggctagcgggctcatcgaatccggtgcccactggtatccgggg
cggccagtgatggtcacccgcaatgactacgaactcggcctgaacaatggcgatattggc
atcgccctgccgctacccgacaccgacgagccgcaccgcaccactctacgggtcgctttc
ccggccgccgacggcggcaaagcggcgttgcgctgggtgctaccggcgcgccttaacaac
atcgaaaccgtcttcgccatgaccgtgcacaaggcccagggctccgagttcgatcacgcc
gccctactgctccccgaccggccgagccccatccttacccgcgaactcatctacaccgcc
atcacccgggcgcggaaccgctttaccctgcttgaccccggccacagtgtcctcgccgcc
ggccttgccgcccgcgtcaaccgcagcgccggcctccacgaccagctcatcggcatgaag
cctccagggaacctctaa

DBGET integrated database retrieval system