KEGG   Halorhodospira halochloris: HH1059_14770Help
Entry
HH1059_14770      CDS       T06158                                 

Gene name
thlA
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hhk  Halorhodospira halochloris
Pathway
hhk00071  Fatty acid degradation
hhk00280  Valine, leucine and isoleucine degradation
hhk00310  Lysine degradation
hhk00380  Tryptophan metabolism
hhk00620  Pyruvate metabolism
hhk00630  Glyoxylate and dicarboxylate metabolism
hhk00640  Propanoate metabolism
hhk00650  Butanoate metabolism
hhk00900  Terpenoid backbone biosynthesis
hhk01100  Metabolic pathways
hhk01110  Biosynthesis of secondary metabolites
hhk01120  Microbial metabolism in diverse environments
hhk01130  Biosynthesis of antibiotics
hhk01200  Carbon metabolism
hhk01212  Fatty acid metabolism
hhk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hhk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HH1059_14770 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    HH1059_14770 (thlA)
   00640 Propanoate metabolism
    HH1059_14770 (thlA)
   00650 Butanoate metabolism
    HH1059_14770 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HH1059_14770 (thlA)
   00072 Synthesis and degradation of ketone bodies
    HH1059_14770 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HH1059_14770 (thlA)
   00310 Lysine degradation
    HH1059_14770 (thlA)
   00380 Tryptophan metabolism
    HH1059_14770 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HH1059_14770 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HH1059_14770 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HH1059_14770 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhk04147]
    HH1059_14770 (thlA)
Enzymes [BR:hhk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HH1059_14770 (thlA)
Exosome [BR:hhk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HH1059_14770 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAU58181
UniProt: A0A125T2P0
Position
1616821..1618005
Genome map
AA seq 394 aa AA seqDB search
MAQRKVTICAPTRTALGTFNGSLAKVPATDLGATVVRSTLERSGLSPDAVDSVVMGNVIQ
AGCKMNPARQASINGGVPAQTPALTVNRVCGSGAQAIANAFQEVALGFADTAIAGGMENM
DRAPYLLMQGRTGYRLGHGQILDAVLNDGLNDAFSDQHSGWHTEDLASEYGISREEQDEW
AARSQQRFSQAQAAGHFNAEITPVDISDRKTTKQFDTDEHNRGDTTAEGLQKLRPAFRKD
GTITAGNAPGVNTGAAAMVIAAEEAAAKHGLTPIAHIASYGIGGVEPGMFGIGPVPAVKQ
CLQRAGWSIDDVERWEINEAFAAIAIAVMRDLGVAEERVNVEGGAIAHGHAIGATGAVLT
TRLLHSMQRDGLKRGVVTMCIGGGQGIALALEMA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcgtaaagtcaccatctgcgccccaacgcgcaccgctttaggaactttcaat
ggctctctagctaaggtcccagctaccgacctaggtgcgacggttgtccgctctacccta
gagcgctcggggctctcaccggatgctgtagacagcgtggtgatgggcaatgttattcaa
gccggctgcaagatgaacccggcacggcaggcctccattaacggcggtgtaccagcccag
acccctgccctgaccgtgaaccgggtttgtggctcgggcgcccaagcaattgccaacgcc
ttccaggaggtagccctgggctttgccgacaccgccatagccggtggcatggagaacatg
gaccgggccccctacctgctcatgcaagggcgcaccggttatcgcctcggacacgggcaa
attcttgatgcggtactaaacgatggcctaaacgatgccttctcagatcagcactcggga
tggcataccgaagaccttgccagcgagtacggtatcagccgcgaggagcaggacgaatgg
gctgcacgctcacaacaacgctttagccaagcccaggcggcaggccattttaatgcggaa
ataaccccggttgacatctccgatcgtaagaccaccaagcaatttgataccgacgaacat
aaccgcggcgacaccacagcggaaggcttacagaagctccggccggcgtttcgcaaggac
ggcactatcactgccggcaatgcccccggcgttaataccggcgctgcagccatggtcatc
gctgctgaagaagctgccgccaaacacggcctcaccccaatcgcccacatagcatcttat
gggattggtggcgttgagccgggcatgtttggaatcggccctgttccggcagtcaaacag
tgtctgcaacgcgccggctggtctattgatgatgtcgagcgctgggagattaacgaggcc
tttgccgccatcgccatcgccgtgatgcgggatctgggcgtcgcggaagagcgggttaac
gttgagggtggggcaatagctcacggccacgccatcggcgcaacaggtgccgtacttacc
acccggttgcttcactcaatgcagcgcgacggcctaaagcgcggtgtggtaaccatgtgt
atcggcggcggccagggaattgcgcttgccctggagatggcatag

DBGET integrated database retrieval system