KEGG   Halorhodospira halochloris: HH1059_18250Help
Entry
HH1059_18250      CDS       T06158                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
hhk  Halorhodospira halochloris
Pathway
hhk00471  D-Glutamine and D-glutamate metabolism
hhk00550  Peptidoglycan biosynthesis
hhk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    HH1059_18250 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HH1059_18250 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hhk01011]
    HH1059_18250 (murD)
Enzymes [BR:hhk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     HH1059_18250 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:hhk01011]
 Precursor biosynthesis
  Amino acid ligase
   HH1059_18250 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C DAO AlaDh_PNT_C NAD_binding_8 TrkA_N Pyr_redox_2 XdhC_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: BAU58514
UniProt: A0A0X8XAM1
Position
complement(1997925..1999313)
Genome map
AA seq 462 aa AA seqDB search
MAGEGHSNNYTAVVGLGVTGLACVRHLRRLGDRVVVLDSRPTPPAKAELQAEHPEVELYC
GSLERQLLFNAKRIVVSPGLDLRYGVWAELRGLGRELCGELTLFAEALSASERGGMGERR
GPQVVAVTGSNGKSTVVSLLAEMARSAGLKVALGGNLGTPALDLLAAGLPDTFILEVSSF
QLETSAGLPVDAAAVLNISPDHMDRYDDLSHYARTKQRLLDKAAVAVINSDDEHVRVMGD
EQRQRVLRFSLDDGSADYSCRPTEEGEYLTVGDQQVIAVSDLALAGRANCANALAAMALA
DACGLPREAQLSGLRSFAGLPHRMERVGEWQGVEWINDSKATNVGAALAALAGVDRQVVL
IAGGQAKGADFRPLAHACVEKARALIIFGEDAPVIEAALAGRVPAVRVADLSEAVSSAVE
LAQPGDCVLLAPACASFDSFSGYEQRGEVFREAVLGEVANHG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgaggggcatagcaacaactacaccgcggtagttgggctgggggtgaccggc
ctggcctgcgtgcgccatctgcgcaggcttggcgacagggtagtggtgctagatagtcgc
cctacgcctcccgctaaagccgagctccaggccgaacacccggaggtcgagctgtattgt
ggcagcctggagcgacagctcttgtttaatgccaagcgcatcgttgttagccccggtttg
gatttgcgttacggtgtttgggctgagctgcgtggcttggggcgcgagttatgcggtgaa
ttgaccctgttcgccgaggctttatcagcgtctgagcggggtggcatgggcgagcggcgc
ggacctcaagtcgttgctgtgaccggctcgaatggcaaaagcactgtcgtcagcttgctt
gctgagatggcacgcagtgccgggttaaaggttgctctgggcggcaacctgggcacgcca
gcactggatctattagccgcaggcttgccggataccttcatccttgaggtctccagcttc
cagctcgagacaagcgccggactgccagttgacgcagccgctgtccttaacatcagtccc
gatcacatggacagatatgacgacctctcccattacgcgcggaccaagcaaagattgctc
gacaaggccgccgttgcggttatcaatagcgatgatgagcatgtccgggtcatgggcgat
gagcaacgacagcgcgtattacgattcagtctcgacgatggcagtgctgactatagttgc
cgccctactgaagagggggaatatctgactgtcggtgatcaacaagtaattgccgtcagt
gacctggcccttgccgggcgggccaattgtgccaatgcccttgccgctatggcgcttgcg
gatgcgtgcggtttaccgcgcgaggcgcagcttagcggattgcgcagttttgccggcctg
ccgcaccgcatggaaagggtaggtgagtggcaaggcgtcgagtggatcaatgactcgaaa
gcaaccaatgtcggagcagcattggcggcacttgctggggtcgacagacaggtagttttg
atagctggcggccaagctaagggagccgacttccgccctctggctcatgcctgtgtcgag
aaagcgcgtgcgctaatcatcttcggcgaggatgccccagtgattgaggcagcattggct
gggcgcgttccagcggtcagggtggctgatctaagtgaagcggtcagctcagcggttgaa
ttagcccagccgggtgattgtgtgctgcttgccccggcgtgtgctagcttcgattctttc
agtggctatgagcagcgcggcgaggtttttcgcgaggcagtgcttggcgaggtggcgaat
catggctga

DBGET integrated database retrieval system