KEGG   Halobacteroides halobius: Halha_0037Help
Entry
Halha_0037        CDS       T02401                                 

Definition
(GenBank) alcohol dehydrogenase, class IV
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
hhl  Halobacteroides halobius
Pathway
hhl00010  Glycolysis / Gluconeogenesis
hhl00071  Fatty acid degradation
hhl00350  Tyrosine metabolism
hhl00620  Pyruvate metabolism
hhl00625  Chloroalkane and chloroalkene degradation
hhl00626  Naphthalene degradation
hhl00650  Butanoate metabolism
hhl01100  Metabolic pathways
hhl01110  Biosynthesis of secondary metabolites
hhl01120  Microbial metabolism in diverse environments
hhl01130  Biosynthesis of antibiotics
hhl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halha_0037
   00620 Pyruvate metabolism
    Halha_0037
   00650 Butanoate metabolism
    Halha_0037
  Lipid metabolism
   00071 Fatty acid degradation
    Halha_0037
  Amino acid metabolism
   00350 Tyrosine metabolism
    Halha_0037
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Halha_0037
   00626 Naphthalene degradation
    Halha_0037
Enzymes [BR:hhl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Halha_0037
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Halha_0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AGB40063
UniProt: L0K7G4
Position
34737..37337
Genome map
AA seq 866 aa AA seqDB search
MAVQEKEVQHRSEAQEMVDGLISKAQKAQKELAQMNQEEIDQIVEEMVLAGVDKHIELAK
LAVEDTGMGVYEDKIAKNIFSTEYIYNDIKDKKTVGVLEENKVEGTVKIAEPVGVIAGIT
PTTNPTSTTMFKALTALKAGNSIVFSFHPSALECSAKSAQILHDAAVKAGAPEGCISWIS
EPSLEATNALMKHDGVDMILATGGAGMVKAAYSSGTPALGVGPGNVPAYVEKSVNLKQAI
NDIVMSKSFDNGTICASEQAIILDKEIAEEAKGLLVQNHCYMLDEKEIKKVEEVAIDKER
NAMSPEVVGQSATKIAQLAGIDVPKDTVVLVAPINGVGPDYPLSREKLSPILALIEVEDS
DEGIQKAIEMTEFGGLGHSAVIHSNDDKVIEEFGNKLQVGRVIVNAPSALGGIGDIYNNF
APSLTLGCGTFGGNAVSENVTVDHLYNVKTVAKRKTERLWVKVPPEIYTEAGSLAKLADE
EGKKAAIITDQVMVDLGYVDQVTEYLEEAGVDYRVFDEVEPDPSVETVMKGKDFIEEFGA
DTIIALGGGSPMDAAKGMWLFYEHPEAKFRDLKLRFADIKKRTYEFPNLGEKAKFIAVPT
TSGTGSEVTAFAVITDKKNDIKYPLASYELTPDMAIIDSDLTMTVPASVTANTGIDVLTH
AIEAYVATLSSDYTDALALQAIRMVFKYLPRAYKNGQQDREAREKMHNASCMAGIAFTNA
FLGINHSLAHILGGKFHIPHGLANGVLMPHVIRYNAATPTKWAIFPNYRYHKADEEYAEI
ARNLGLEANTPEEGVENLVEAIKDLMKELDMPLTIADCDIEWSDFEEKISEMADVAFNDQ
CTPANPRKPRVSELEEIYKKAYGDRK
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcaagagaaagaggttcaacataggtcagaggctcaagagatggttgatggt
ttaatttctaaggcgcaaaaggcacaaaaagaattagctcagatgaatcaagaagagatt
gatcaaattgtcgaagaaatggttttagctggtgtagataagcatattgagctagctaag
ttagcagtagaggatactggtatgggggtttatgaagataagatagctaagaatattttt
tctactgaatatatttataatgatattaaagataaaaagacagttggagtattagaagaa
aataaagtagaaggtactgttaagattgctgaacctgttggtgtaattgctggtatcact
ccaacaaccaatccaacttcaactaccatgtttaaggctttaactgccttaaaggctgga
aactcaattgtatttagttttcacccaagtgctttagaatgtagtgctaaatcagctcag
attttacatgatgctgcagttaaagcaggtgctcctgaaggttgtattagttggattagt
gaaccttctttagaagctacaaatgcattaatgaaacatgatggtgtagatatgatttta
gcaactggtggagccgggatggttaaggcagcttatagttctggtactcctgcattaggt
gttggcccaggtaatgtgccagcttatgtagagaaatctgttaatttaaagcaagcaatt
aatgatatagtaatgagtaaatcttttgataatggtactatttgtgcttctgaacaagcg
atcattcttgataaagagattgctgaagaggctaaaggattattagtccaaaatcattgt
tatatgttagatgagaaagaaattaaaaaggtagaagaagttgctatagataaagaaaga
aatgctatgagtcctgaggttgtaggacagtcagctactaagattgcccagttagctgga
attgatgttcctaaagatacagttgtgttagttgctcctattaatggggttggcccagat
tatcctttatctagagagaagttaagtcctatcttagctttaattgaagttgaagattct
gatgaaggaattcaaaaagctattgaaatgactgaatttggtggattaggacactctgct
gtaattcattctaatgatgataaagtgattgaagagtttggtaacaaactgcaagttggt
agagttattgttaatgctccaagtgctttaggtggtattggagatatttacaataatttt
gcgccatcattaactctaggctgtggaacatttggtggtaatgcagtaagtgaaaatgta
actgtagatcacctatacaatgtaaagacagttgctaaacggaagactgaaagattatgg
gttaaagtaccacctgagatttatacagaagcaggatcattagctaaattagctgatgaa
gaaggaaaaaaggctgcaattattactgatcaagtaatggttgatttaggctatgtagat
caagtgactgaatatttagaggaagctggagtagattatagagtctttgatgaagttgaa
cctgatccttctgttgaaacagtaatgaaagggaaagactttattgaagagtttggagca
gatactattattgctcttggtggtggatctccaatggatgctgctaagggaatgtggtta
ttctatgaacatccagaagctaaatttagagatttaaagcttagatttgctgatattaag
aagagaacttatgaatttcctaatttaggagaaaaagcaaagtttattgcagtaccaaca
actagtggtactggttctgaggtaactgcttttgctgtaattactgataagaagaatgac
attaagtatccactagcttcttatgaattgactccagatatggcaattattgattctgat
ttaactatgactgtgccagctagtgtaactgctaatactggtattgatgttttaactcat
gctattgaagcttatgtagctactttatcttctgattatacggatgctttagctttacaa
gctattagaatggtttttaagtatttaccacgtgcttataagaatggtcaacaggataga
gaagctagagaaaaaatgcataatgcttcttgcatggcaggaattgcctttactaatgct
ttcttaggtattaatcacagtttagctcatattttaggtggaaaattccatattccacat
ggattagctaatggagtattaatgccccatgtaattagatataatgctgcgacacctaca
aagtgggctattttccctaattatagatatcataaagcagatgaggaatatgctgaaatt
gctagaaatttagggttggaggctaatacgccagaagagggtgtagaaaatttagttgaa
gctattaaagatctgatgaaagaattagatatgccattaacaattgctgattgtgatatt
gaatggtcagattttgaagaaaagattagtgaaatggcagatgtagcattcaatgaccag
tgtacacctgctaatccacgtaaaccaagagtaagtgagttagaagaaatttataaaaaa
gcttatggtgatagaaagtag

DBGET integrated database retrieval system