KEGG   Halobacteroides halobius: Halha_0240Help
Entry
Halha_0240        CDS       T02401                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hhl  Halobacteroides halobius
Pathway
hhl00071  Fatty acid degradation
hhl00280  Valine, leucine and isoleucine degradation
hhl00310  Lysine degradation
hhl00362  Benzoate degradation
hhl00620  Pyruvate metabolism
hhl00630  Glyoxylate and dicarboxylate metabolism
hhl00640  Propanoate metabolism
hhl00650  Butanoate metabolism
hhl00900  Terpenoid backbone biosynthesis
hhl01100  Metabolic pathways
hhl01110  Biosynthesis of secondary metabolites
hhl01120  Microbial metabolism in diverse environments
hhl01130  Biosynthesis of antibiotics
hhl01200  Carbon metabolism
hhl01212  Fatty acid metabolism
hhl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Halha_0240
   00630 Glyoxylate and dicarboxylate metabolism
    Halha_0240
   00640 Propanoate metabolism
    Halha_0240
   00650 Butanoate metabolism
    Halha_0240
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Halha_0240
   00072 Synthesis and degradation of ketone bodies
    Halha_0240
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Halha_0240
   00310 Lysine degradation
    Halha_0240
   00380 Tryptophan metabolism
    Halha_0240
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Halha_0240
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Halha_0240
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Halha_0240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhl04147]
    Halha_0240
Enzymes [BR:hhl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Halha_0240
Exosome [BR:hhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Halha_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGB40252
UniProt: L0K4Q5
Position
complement(238721..239875)
Genome map
AA seq 384 aa AA seqDB search
MKDVFIIGGLRSPIGKTNGQLKDFLPEKLAANILNQTINKYNLTANKIDEVILGNAVGLG
GLARLSLLEAGWPVRIPGTTIDFQCGSGLSAINLGANLIRSGQAELIVAGGVESTSLEPR
RQLNPNDPRFTREDNYLDRAIFSSSSLGDPDMGQAAEKVAQLKDISRQAMDQWALRSHQK
ATKTKQKGLLDEIIAPIKKDNQKIDSDESIRPNISLKLLERMPPAFVTEGRVTAGNACLT
HDGAAVIILASKEAVKEYNLTPEAKFIQGATVGVNPNLSPLGPIPAIKKLLQEKNISITK
IDALEINEAFAVKILACLQELNITKNKVNILGGALAYGHPYGASGAIILLHLLQALKEVQ
GELGITSLGVAGGQGIATLIRRAT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtatttattataggagggctaagatctcctattggtaaaactaatggacaa
cttaaagatttcttgccagaaaaactagctgctaatatcttaaaccagactataaacaaa
tataatttaacagcaaataaaatagatgaagtcatattaggtaatgctgtaggattaggc
gggttggcccgcctttctttattagaagcaggttggcccgttagaatccctggtactact
attgattttcagtgtggttcaggtcttagtgctatcaatctaggggccaacttaatccga
agtggacaagccgagcttattgtagctggtggagtagaaagtacaagtctagaaccacgt
cgtcaattgaatcctaatgaccctcggtttactagagaggataattatctcgacagagct
atcttctcttcttcctctttaggtgatccagatatgggccaagctgccgaaaaagtagcc
caactaaaggatatatcacgacaagctatggatcagtgggcactaagaagccaccagaaa
gcaactaagactaaacaaaaaggactactagatgaaatcatagcacctatcaaaaaagat
aaccaaaagatagacagtgacgaatctattcgccctaatatatcacttaaactactagaa
agaatgccaccagcctttgtaacagaagggagagtaaccgctggtaatgcctgtctgacc
catgatggagcagcagtaatcattctagcctctaaagaagcagttaaagaatataatcta
actccagaagctaaatttattcaaggagctacagtaggagttaaccctaacttgtctcct
ttagggccaattccagctattaagaaactacttcaagaaaaaaatatttctatcactaag
attgatgctttagaaatcaacgaagcctttgctgtcaaaatcctagcttgtttacaagag
cttaacataacaaaaaataaggttaatattttaggaggagccttagcttatggtcatcct
tatggtgcttcaggagctattatacttctgcatttactacaagcactaaaggaagttcaa
ggggagttaggaatcacttctctcggtgttgcaggtggccaaggaatagctacattgatt
aggagagccacttaa

DBGET integrated database retrieval system