KEGG   Halobacteroides halobius: Halha_1980Help
Entry
Halha_1980        CDS       T02401                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
hhl  Halobacteroides halobius
Pathway
hhl00330  Arginine and proline metabolism
hhl00332  Carbapenem biosynthesis
hhl01100  Metabolic pathways
hhl01130  Biosynthesis of antibiotics
hhl01230  Biosynthesis of amino acids
Module
hhl_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Halha_1980
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Halha_1980
Enzymes [BR:hhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Halha_1980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGB41879
UniProt: L0KBY8
Position
complement(1987708..1988823)
Genome map
AA seq 371 aa AA seqDB search
MRKKIKEAERIVIKIGSSTLTYQNSKLNLGRIEKLIREIVNLKNQGKEVILVSSGAVAAG
YGRLKLEASPGTIPEKQALAAIGQGTLMRTYQTIFSEYGYQVGQVLLTQKDLTDRKRYLN
SRNTLYQLLDYNVIPVINENDTVAVKEIKFGDNDTLSALVSSLVGADLLVILSDIDGLYT
ADPRNDDSAKLISQVEEISSEIEELAGGAGTDRGTGGMATKIDAAKIATKAGLPLVIANG
SLDQVVTKISEGEDLGTLFLPDSGMTSREQWIAFNLDIAGKIVIDEGATLALTKEGGSLL
ACGIVEARGEFSVGDVVDIIDQSGSRIAKGLVNYDQPEVDKIKGFQSEEIKSRLGYQAYD
EVVHRDNLVLL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaaaaataaaagaagcagaaagaatagtgattaagattggtagtagtacttta
acttaccaaaattctaagttaaatttagggcggatagagaaattaattagagaaattgtt
aatttgaagaatcagggtaaagaagttatattagttagttctggtgcagttgcagctgga
tacgggagattaaaactagaggcttctccaggtacaattcctgaaaaacaggctttagct
gctattggccaaggaactttaatgagaacttatcagacaatctttagtgagtatggatat
caggtaggtcaagttttattgacccagaaggatttaacagataggaagcgatatcttaac
tctcgtaatactttatatcagttattagattataatgtgattccagtgattaatgaaaat
gatactgtagcagttaaagagattaaatttggtgataatgataccttatctgctttagta
agtagtctcgttggagctgatttgttggttattttatctgatatagatggtttatacact
gctgaccctcgtaatgatgattcagctaaattgattagtcaagttgaagaaatctcttca
gagattgaagaattagccggaggcgctggaactgatcgcggcacaggaggaatggctact
aagattgatgcagctaagattgctaccaaagcagggttaccattggttatagctaatgga
agtttggatcaagtggtgactaaaattagtgaaggcgaagatttaggaactctctttttg
cctgattcagggatgactagtcgagaacaatggatagcatttaatttagatattgctggt
aaaatagtgattgatgaaggggctaccttggcccttactaaagagggaggtagtctatta
gcttgtggtattgtagaagctagaggagaattttcggttggtgatgtagttgatattatt
gatcaatccggaagtaggattgctaaaggattggttaattatgaccaaccagaagtagat
aagattaaaggcttccagtcagaagaaattaaatctagattgggttatcaagcttatgat
gaagtagttcatcgtgataatttagttttattataa

DBGET integrated database retrieval system