KEGG   Halobacteroides halobius: Halha_2127Help
Entry
Halha_2127        CDS       T02401                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hhl  Halobacteroides halobius
Pathway
hhl00010  Glycolysis / Gluconeogenesis
hhl00052  Galactose metabolism
hhl00500  Starch and sucrose metabolism
hhl00520  Amino sugar and nucleotide sugar metabolism
hhl00521  Streptomycin biosynthesis
hhl01100  Metabolic pathways
hhl01110  Biosynthesis of secondary metabolites
hhl01120  Microbial metabolism in diverse environments
hhl01130  Biosynthesis of antibiotics
hhl01200  Carbon metabolism
Module
hhl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hhl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halha_2127
   00052 Galactose metabolism
    Halha_2127
   00500 Starch and sucrose metabolism
    Halha_2127
   00520 Amino sugar and nucleotide sugar metabolism
    Halha_2127
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halha_2127
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Halha_2127
Enzymes [BR:hhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Halha_2127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AGB42010
UniProt: L0KBT5
Position
complement(2126478..2127449)
Genome map
AA seq 323 aa AA seqDB search
MKQEYVIGIDLGGTKILTALADLEGNILAEVRKPTEADKGKNSVIAKIKDTIYEVLGQTE
VAIEEVEGIGLGSPGPLNIEEGIIYHTPNLNLDNVNIIEELKDVGPPIFLENDANAAALG
EKYFGAGKDAQDLIYVTVSTGIGGGIIIGGEVYHGASDGAGEIGHLTLLPNSDQKCGCGN
YGCWEAVASGTALSRLGREAVKNGEDTLLADLVDDATEVNGAVIAKAAKKGDQVASEIVE
QIAEYLGIGFASLINIFNPEKIIIGGGVSKSWPLLQDTVLANVEQRAMEALTAEVEIVTS
QLEDKIGVKGAIATALVGLKELS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaagaatatgtgattggtattgatctaggtggtactaagattttaactgcttta
gctgatttagaaggtaatatattagctgaggtaagaaagccaactgaagctgataaagga
aagaatagtgtaattgctaaaattaaggatactatttatgaagtattagggcaaacagag
gtagcaatagaagaagtggaaggaattgggttaggatcccctggtccgcttaatattgaa
gaaggaattatttatcatactcctaatctaaatctagataatgtaaatattattgaagaa
ttaaaggatgttggtcctcctatattcctggaaaatgatgctaatgcagctgcattagga
gaaaagtattttggagcaggtaaagatgctcaagatttaatttatgtaactgtaagtaca
ggaattggtggtgggattattattggtggtgaggtatatcatggtgctagtgatggtgct
ggagaaattggtcatttaaccttattgcccaatagtgatcaaaagtgtggttgtggtaat
tatggttgttgggaggcagtagcttctggaacagcattaagcagattagggcgtgaagct
gtcaaaaatggtgaagatactttattagctgatttagtagatgatgcaactgaggttaat
ggagctgtgattgctaaagcagctaaaaaaggagatcaagtagcttctgaaatagtagag
caaatagcagagtatttagggattgggtttgctagtttaatcaatattttcaatccagaa
aaaataatcattggtggaggagtatcaaagtcttggcctctattacaggatactgttttg
gctaatgttgaacaaagagctatggaagcgttaactgctgaagtagaaattgtcacttct
cagttagaggataaaataggagtaaaaggagctattgcgacagctttagtaggcttaaaa
gaattgtcttaa

DBGET integrated database retrieval system