KEGG   Halobacteroides halobius: Halha_2423Help
Entry
Halha_2423        CDS       T02401                                 

Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
hhl  Halobacteroides halobius
Pathway
hhl00540  Lipopolysaccharide biosynthesis
hhl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Halha_2423
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hhl01003]
    Halha_2423
   01005 Lipopolysaccharide biosynthesis proteins [BR:hhl01005]
    Halha_2423
Enzymes [BR:hhl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     Halha_2423
Glycosyltransferases [BR:hhl01003]
 Polysaccharide
  Bacterial polysaccharide
   Halha_2423
Lipopolysaccharide biosynthesis proteins [BR:hhl01005]
 Lipid A
  Halha_2423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB Epimerase_2 Glyco_transf_4 Glyco_trans_4_2 DUF354 Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: AGB42297
UniProt: L0KAI8
Position
complement(2432776..2433903)
Genome map
AA seq 375 aa AA seqDB search
MVVAGEASGDMHATKVIKEIKKLNPDVEFFGFGGQQMKQAGVEILYDPTKLSTIGFAEAI
KHLKLMYDKLNQLEEAMKERKPDVVFLVDYSGFNMKVAKRAAKLGIPVVNYFAPSAWVWG
KWRAKRMAKYGAKIASVFPMEEKVYRKAGADVEFVGHPLLDMVEPQLSYQEFKEEFKLDL
TGKVIGLLPGSRQQELDSLLGPMLEAADIISSHFSITNFILPVAETIDQTKIKEKIKDYK
VDVQLVTGHSYEVMEVTDLLLVASGTATLEAACLQTPMVIAYQTSWSTYWLGKLLVKLPF
IGLPNIISEKEIVPELLQNEVTGSNLAKEVINILDSERKVNQIKKDLANIKAKLGPKNAT
KQVARLVLDTGGIVI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggtagtagcaggagaggcttcgggtgatatgcatgctacaaaagttattaaagagatt
aaaaagttaaatcctgatgtagaattttttggttttggcggacaacagatgaaacaagca
ggggtagaaattttatacgaccctactaaattaagtaccattggttttgctgaagcaatt
aaacatttaaaattaatgtatgataaattaaatcaattagaagaagcaatgaaagaaaga
aagccagatgttgtttttttggtagattattctggttttaatatgaaagtagctaaacga
gctgctaaattaggaattccagtagttaattattttgctccttctgcttgggtatggggt
aaatggcgggccaaaagaatggcgaaatatggagctaagattgcatctgtttttcctatg
gaagagaaggtttaccgtaaggcaggagctgatgtagaatttgtaggccatcctttattg
gacatggtagaaccacaattaagttatcaggagtttaaagaagaatttaagcttgattta
acaggaaaagtaattggattactacctgggagccgccaacaggagttagatagtttatta
gggccaatgttagaagcagcagatataattagcagtcacttttctattactaattttatt
ttaccagtagctgagactatagatcaaactaaaataaaggaaaaaattaaagattataaa
gtagatgtacaattggttacgggccattcttatgaagtaatggaggtaactgatttatta
ttagtagcctcaggaactgctactttagaagcagcctgcctgcaaacaccaatggtaatt
gcttatcagacttcttggtctacctattggttaggcaaactattagttaagttaccattt
attggtttgccaaatattatatctgaaaaagaaatagtccctgaattattacaaaatgag
gttacaggtagtaatttagctaaagaagtaattaatattttagattcagaaagaaaagtt
aatcagataaaaaaagatttagcaaatattaaagcaaaattaggtcctaagaatgctact
aaacaagtagctaggctggtattagatacaggaggaattgtgatatga

DBGET integrated database retrieval system