KEGG   Halobacteroides halobius: Halha_2519Help
Entry
Halha_2519        CDS       T02401                                 

Definition
(GenBank) family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
hhl  Halobacteroides halobius
Pathway
hhl00052  Galactose metabolism
hhl00561  Glycerolipid metabolism
hhl00600  Sphingolipid metabolism
hhl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Halha_2519
  Lipid metabolism
   00561 Glycerolipid metabolism
    Halha_2519
   00600 Sphingolipid metabolism
    Halha_2519
Enzymes [BR:hhl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Halha_2519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AGB42393
UniProt: L0KE98
Position
complement(2532640..2533935)
Genome map
AA seq 431 aa AA seqDB search
MPKITFMGAGSTVFAKNVLGDCLLTPALKDSQIALYDIDQQRLKDSEMMLNNLNQNYDGD
AKIVAYNDRKEALRDADYVVNAIQVGGYKPCTVTDFEIPNKYGLRQTIGDTLGIGGIFRA
LRTIPILLDFAKDMEEVCPDAWFLNYTNPMSMLTGAMLKATNIKTVGLCHSVQKCVSELL
EPLGMSPEGVQWKVAGINHMSWLLEVTRDGKNLYPKIKEKAFSREDSHDDLVRYEMMKRF
GYYVTESSEHNAEYLPYFIKSQYPELIDKFNIPLDEYPRRCEKQIQEWEEMRDELVNNED
LEHQRSHEYASYIIEAMETGEPYKIGGNVLNTDLITNLPNEAVVEVPCLVDKSGVTPCHV
GELPLQLAALNRTNINVDLLTIEAALTKKKDYIYQAAMLDPHTSAELSIDEIISLCDDLI
VAHGDWLPEFN
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaatcacatttatgggagcaggtagtactgtttttgctaagaatgtactagga
gattgtctattgacgccagcactgaaagattctcagattgctttatatgatatcgaccag
caaagattaaaagattctgaaatgatgcttaataatcttaaccaaaattatgacggagat
gcaaagattgttgcttataatgatcgaaaggaggctttaagagatgcagattatgtagta
aatgcaattcaggtaggcggttataaaccttgcacagtaactgattttgaaattcctaac
aagtatggcttacgtcagacaattggagatactttaggaattggcggtatctttagagca
ttaagaactattcctatcttacttgactttgctaaagatatggaagaagtatgtccagat
gcttggtttttaaattatactaatccaatgtctatgttaactggtgctatgttaaaagct
actaatataaagacggtaggtttatgtcacagtgttcaaaagtgtgtatcagaactgtta
gagccgttaggaatgagtccagaaggtgtacaatggaaagtagcggggattaatcatatg
tcttggttgttagaagttacaagagatgggaaaaatttatatccaaaaatcaaagaaaaa
gcatttagtagagaggattcacatgatgatttggtacgttatgaaatgatgaaacgtttc
ggttattatgtaactgaatctagcgaacataatgcagaatatttaccttattttattaag
agtcagtatccagaattaattgataagtttaatattcccttagatgaatacccacgtcgt
tgtgaaaaacaaattcaagagtgggaagaaatgagagatgaactagttaataatgaggac
ttagaacatcagcgtagtcacgaatatgcctcttatattatagaagcaatggagacagga
gagccttataaaattggtgggaatgtattaaatacagatttaattactaacttacctaat
gaggctgtggttgaagtgccatgtttagttgataaaagtggtgtaacaccttgccatgta
ggagaattaccactacagttagctgctttaaatagaactaatattaatgttgatcttttg
acaattgaagctgccttaactaagaagaaggattatatctatcaggctgctatgttagat
cctcatacttctgctgagttatcaatagatgaaattatctctttatgtgatgatttaatt
gtagctcatggtgattggttaccagaattcaattag

DBGET integrated database retrieval system