KEGG   Helicobacter heilmannii: BN341_16810Help
Entry
BN341_16810       CDS       T02626                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hhm  Helicobacter heilmannii
Pathway
hhm00071  Fatty acid degradation
hhm00072  Synthesis and degradation of ketone bodies
hhm00280  Valine, leucine and isoleucine degradation
hhm00310  Lysine degradation
hhm00362  Benzoate degradation
hhm00380  Tryptophan metabolism
hhm00620  Pyruvate metabolism
hhm00630  Glyoxylate and dicarboxylate metabolism
hhm00640  Propanoate metabolism
hhm00650  Butanoate metabolism
hhm00900  Terpenoid backbone biosynthesis
hhm01100  Metabolic pathways
hhm01110  Biosynthesis of secondary metabolites
hhm01120  Microbial metabolism in diverse environments
hhm01130  Biosynthesis of antibiotics
hhm01200  Carbon metabolism
hhm01212  Fatty acid metabolism
hhm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hhm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN341_16810
   00630 Glyoxylate and dicarboxylate metabolism
    BN341_16810
   00640 Propanoate metabolism
    BN341_16810
   00650 Butanoate metabolism
    BN341_16810
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN341_16810
   00072 Synthesis and degradation of ketone bodies
    BN341_16810
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN341_16810
   00310 Lysine degradation
    BN341_16810
   00380 Tryptophan metabolism
    BN341_16810
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN341_16810
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN341_16810
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN341_16810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhm04147]
    BN341_16810
Enzymes [BR:hhm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN341_16810
Exosome [BR:hhm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN341_16810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCM10718
Position
complement(1537093..1538268)
Genome map
AA seq 391 aa AA seqDB search
MHEVHIYSAKRTPIGSFNGTLSSVPATKLGALAAEQALLASGFDASFVDSCIVGNVLSSG
LKQAPARQVALGANLPKSIACWLVNEACGSSLRAVMLGANEIALGRSRVSMVGGMENMSL
APHLLMKSRAGFKMGDTALEDSMLKDGLQDAYKKARMGDFAENYARLNHLSRAEQDSFAK
ASYEKALRAIENHAFKPEMFSVSMRGRTDEIVVSADEEPTRVNFDKGLKLKPVFDPEGTI
TAFNSSKISDGASMLVLGSANLSKETSTKALAKIVDYTSFSHDPHLFTAAPAPAIRKLLK
NNNKQIGDIDLYEISEAFAVVGILTQKDLGLKDSQINVNGGAIALGHPIGTSGARILTTL
VHALHFYDKHLGVACLCVGGGEALAILVERL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaagtccatatttacagtgccaaacgcacccccattgggtcttttaacggcact
ctctctagtgttcctgccacaaagttgggggctttggcagctgagcaggccttgcttgca
agtggatttgatgccagctttgtagatagttgcattgtcggcaatgtacttagcagtggg
ttaaaacaagctcccgctagacaagtcgccctaggggcgaatttgcctaagtccatcgcc
tgttggctagtcaatgaggcttgcgggtcgagcttgagggcggtgatgctcggggcaaat
gagatcgctttagggcgtagccgggtgtctatggtggggggcatggagaacatgagcctt
gccccgcatttgctcatgaaaagccgggcgggctttaaaatgggcgacactgccttggag
gatagtatgcttaaagacggcttgcaagatgcctacaaaaaggcacgcatgggcgacttt
gctgaaaattacgcccgtttaaaccacctaagccgggcagaacaagacagctttgccaaa
gccagctatgaaaaagcccttagggccattgaaaaccacgcctttaaacccgagatgttc
agcgtgtccatgcgcgggcgcacagatgagatcgtggtgagcgcggatgaagagcccact
agagttaattttgacaagggcttgaagctcaaacccgtctttgatcccgagggcaccatc
accgcctttaactccagtaagatcagcgatggggcgagcatgctcgtgctaggctctgcc
aacctatctaaagaaacctccactaaagccctagccaagatcgtggattacacatccttt
agccacgacccccacttatttaccgctgcgcccgctcccgccattagaaagcttttaaaa
aacaacaataaacaaatcggcgacattgatctctatgagatcagcgaggcgtttgcggta
gtggggattttgacccaaaaagatttgggccttaaggacagccaaatcaatgtcaatggg
ggggcgatcgctttaggccaccctattggcaccagcggggctaggattttaacgactttg
gtgcatgccctacatttttacgataaacatttgggcgtggcgtgtttgtgtgtgggcggg
ggcgaggcattggcaatccttgttgagcgcctgtaa

DBGET integrated database retrieval system