KEGG   Helicobacter heilmannii: BN341_19160Help
Entry
BN341_19160       CDS       T02626                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
hhm  Helicobacter heilmannii
Pathway
hhm00540  Lipopolysaccharide biosynthesis
hhm01100  Metabolic pathways
Module
hhm_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hhm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BN341_19160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hhm01005]
    BN341_19160
Enzymes [BR:hhm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     BN341_19160
Lipopolysaccharide biosynthesis proteins [BR:hhm01005]
 Unusual sugar
  BN341_19160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: CCM11158
Position
1739192..1740160
Genome map
AA seq 322 aa AA seqDB search
MYIPNTLENKTIVITGGAGFIGSNLAMYFQTHHPKARVIVIDKFREQTPPTTSLGHFKNL
LDFHGEIITADITKDLGVLKKLDFDYLFHQAAISDTTNLNQELVMKTNHQAFIKLLKIAI
KKDARVIYASSAGVYGNTPAPNKVGFGQKPENIYGFSKLCMDKSALDFAHESFMPIVGLR
YFNVYGPGEFYKHKTASMVLQLGLQALQYKEVKLFEFGEQKRDFVYIEDVIQACVKAMSA
SVSGVYNVGYGKSHSYNDIVRLLQEHLGDFKVTYIKNPYDFFQEHTCADIVPTHADLDYA
PSYDLAKGIKTYLPTIRELAKC
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgtacatccccaacaccctagagaataaaaccattgtgatcaccggcggggcgggcttt
atcggcagcaatttggcgatgtattttcaaacccaccaccccaaggcgcgggtgattgtg
atcgataagtttagagagcaaaccccccccaccacgagtttagggcattttaaaaacctc
ttagactttcatggcgaaatcatcaccgcagacatcaccaaagatctaggcgtgttgaag
aaactggactttgactatttgtttcaccaagcggcgatctccgacaccacgaatttaaat
caagagttggtgatgaaaaccaaccaccaagccttcatcaagcttttaaaaatcgcgatc
aaaaaagacgcgcgggtcatttacgcctcttcggccggcgtttatggcaacacccccgcg
cctaataaagtcggtttcgggcaaaaacctgaaaatatctatggcttttctaaactttgt
atggataaaagcgcactagacttcgcccatgagagtttcatgcccattgtgggcctgcgc
tattttaatgtctatggcccgggggagttttacaagcacaaaaccgcgtccatggttttg
caactgggtttgcaagccctgcagtataaagaagtgaaactctttgaatttggggagcaa
aaacgcgactttgtgtatatcgaggatgtgatccaagcttgcgtgaaggcgatgagcgcg
tctgtcagcggagtgtataatgtgggctatggcaagagccacagctacaacgacatcgtg
cgcctgttgcaagaacatttgggcgactttaaagtaacctacattaaaaacccctatgac
ttcttccaagagcacacctgtgccgacattgtccccacgcatgccgacttggactacgcc
cctagctacgacttagcaaaggggattaaaacctatcttcccaccattagagagctcgct
aagtgttga

DBGET integrated database retrieval system