KEGG   Haloarcula hispanica N601: HISP_11430Help
Entry
HISP_11430        CDS       T02949                                 

Definition
(GenBank) precorrin-2 oxidase/ferrochelatase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
hhn  Haloarcula hispanica N601
Pathway
hhn00860  Porphyrin and chlorophyll metabolism
hhn01100  Metabolic pathways
hhn01110  Biosynthesis of secondary metabolites
hhn01120  Microbial metabolism in diverse environments
Module
hhn_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:hhn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HISP_11430
Enzymes [BR:hhn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     HISP_11430
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     HISP_11430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Oxidored_nitro CysG_dimeriser
Motif
Other DBs
NCBI-ProteinID: AHB66581
UniProt: V5TMP9
Position
1:complement(2173945..2174592)
Genome map
AA seq 215 aa AA seqDB search
MIPLMHDFEGETVLVVGGGPVGARKARTFATEASVVVLSPEFADRAFADAEKVRAAPDPE
DAEEWVERTDPALVVAATDDSALNDAFTAVAEEHGALVNRADDHGDQSFGNVVVPATVRD
DPVTLAIATGGRAPALSKHLRERFEDEFGNAGLMAELVGDLREDLRDRGVPPAERRDAVR
LVVRSREVWKALDSGRYKGEQVARDVIGELPGDQT
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgattccgctcatgcacgacttcgagggcgagacagtgctcgtcgtcggcggcggtccg
gtcggtgcgcgcaaggcccgaacgttcgccacggaggcgagcgtcgtcgtcctcagtccc
gagttcgccgaccgggcgttcgcggacgccgaaaaggtccgggccgccccggaccccgag
gatgccgaagaatgggtcgagcggaccgacccggcactggtcgtcgccgcgacggacgac
tcggccctgaacgacgccttcaccgcggttgccgaggagcacggcgcgctcgtcaaccgt
gccgacgaccacggtgaccagtcgttcggcaatgtcgtcgtcccggcgacagtgcgggac
gacccggtgacgctggcgattgcgaccggcgggcgcgcgccggcgctgtcgaaacacctc
cgcgagcgtttcgaagacgagttcggaaacgccggtctgatggcggaactcgttggtgac
ctccgtgaggacctgcgcgaccggggcgtcccgccggccgaacgacgtgacgccgttaga
ctcgttgtcaggtcacgggaagtttggaaggctttagatagtggcaggtacaagggagag
caagtagctagagacgtgatcggagagttacctggtgatcaaacgtga

DBGET integrated database retrieval system