KEGG   Haloarcula hispanica N601: HISP_17025Help
Entry
HISP_17025        CDS       T02949                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hhn  Haloarcula hispanica N601
Pathway
hhn00010  Glycolysis / Gluconeogenesis
hhn00053  Ascorbate and aldarate metabolism
hhn00071  Fatty acid degradation
hhn00280  Valine, leucine and isoleucine degradation
hhn00310  Lysine degradation
hhn00330  Arginine and proline metabolism
hhn00340  Histidine metabolism
hhn00380  Tryptophan metabolism
hhn00410  beta-Alanine metabolism
hhn00561  Glycerolipid metabolism
hhn00620  Pyruvate metabolism
hhn00625  Chloroalkane and chloroalkene degradation
hhn01100  Metabolic pathways
hhn01110  Biosynthesis of secondary metabolites
hhn01120  Microbial metabolism in diverse environments
hhn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hhn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HISP_17025
   00053 Ascorbate and aldarate metabolism
    HISP_17025
   00620 Pyruvate metabolism
    HISP_17025
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HISP_17025
   00561 Glycerolipid metabolism
    HISP_17025
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HISP_17025
   00310 Lysine degradation
    HISP_17025
   00330 Arginine and proline metabolism
    HISP_17025
   00340 Histidine metabolism
    HISP_17025
   00380 Tryptophan metabolism
    HISP_17025
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HISP_17025
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HISP_17025
Enzymes [BR:hhn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     HISP_17025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHB67726
UniProt: V5TQY9
Position
2:231553..233004
Genome map
AA seq 483 aa AA seqDB search
MEYTGPTDLYIGGEWREATNGGSIETEDPATEQPYASVQKAEATDIDDAVQAAQAAVEGG
SEWATMDPGTRRAKLHAMADAIEEMKDELSMVESHDNGKTPFEAGLEIDMVTDTFRHYAG
WTDKIRGDEIPVESGRLNYTTREPVGVTAHIAPWNYPFQLAGRGLAPALAAGNSVILKPS
AMTPLSALYYAKAAEEAGLPDGVVNVVPGKGSEAGDALTGHEGVDHVTFTGSTGVGKTVQ
RSAANAVADVTLELGGKGPAVVFPDADLDAAARGIQYGIFMNAGQMCWANSRIVVHEDVY
DEMVSRMAEIAENIPLGGGIDDDGQMGPVVSAGQQQEILDYIETGKEEGATVVAGGGVPA
DRDTGHFVEPTVFADVDNGMTIAQEEIFGPVLTAIEVSDEEEASAVANDSPFGLTACVWT
NDLTRAHTVTDSLDYGMVMVNETPNTWPQTPFGGTKQSGHGRAQGEQAIEAYTEVKNVHI
NLG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggagtacaccggcccgacagacctgtatatcggcggcgaatggcgagaagcgaccaac
ggcggcagcatcgagacggaggacccggcaactgaacagccctacgcgtcggtacagaag
gccgaggcgactgatatcgacgatgcggtacaggcggcacaggcggccgtcgaaggcggc
tccgagtgggcgacgatggacccgggaacgcgccgggcgaaactccacgcgatggccgac
gccatcgaggagatgaaagacgaactgtccatggttgaatcccacgacaacgggaaaacg
ccgttcgaagcggggctagaaatcgacatggtcaccgatacgttccgccattacgccggc
tggacggacaagatccgcggtgacgagattcctgtcgagagcggtcggctcaactacacc
acccgtgagccggtcggtgtgactgcacacatcgcgccgtggaactatcccttccagctc
gccggccgcggcctggcaccggcgctggcggcggggaacagcgttatcctcaagccgtcc
gctatgacgccgctgtcggcgctgtactacgcgaaagccgccgaagaagcgggccttccg
gatggtgtcgtcaacgttgttcccgggaaggggtccgaggccggcgacgcactcaccgga
cacgagggcgtcgatcacgtcaccttcaccgggagtacaggtgtcggaaagacggtccag
cgcagtgctgccaacgcggtcgccgacgtgacgctcgaactcggcgggaaggggccggca
gtcgtgttccccgacgctgacctcgatgccgccgcccgcggcatccagtacgggattttc
atgaacgccgggcagatgtgctgggcgaactcgcgtatcgtcgtccacgaggacgtctac
gacgagatggtctcccggatggcagagatcgcagagaacatcccactcggcggtggcatc
gacgacgatgggcagatgggaccagtcgtcagcgcgggccagcaacaggagatactcgac
tacatcgagaccggcaaggaggagggtgcgactgttgtggctggtggtggcgttcctgcg
gacagagacaccggtcacttcgtcgagccgaccgtctttgccgacgtggacaacgggatg
acgattgcacaggaggagatcttcggtcccgtgctcaccgcaatcgaagtgagcgacgag
gaagaagcgagtgcggtcgcaaacgattcaccgtttggcctcaccgcctgcgtctggacg
aacgacctgactcgcgcacacaccgtcacagacagcctggactacgggatggtgatggtc
aacgagacgcccaacacctggccacagacaccctttggcggcacgaaacagagcggccac
ggccgcgcacagggcgagcaggctatcgaggcctacaccgaggtgaaaaacgtccacatc
aacctcggctga

DBGET integrated database retrieval system