KEGG   Hydrogenobaculum sp. HO: HydHO_1214Help
Entry
HydHO_1214        CDS       T02482                                 

Definition
(GenBank) N(2),N(2)-dimethylguanosine tRNA methyltransferase
  KO
K00555  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase [EC:2.1.1.215 2.1.1.216]
Organism
hho  Hydrogenobaculum sp. HO
Brite
KEGG Orthology (KO) [BR:hho00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hho03016]
    HydHO_1214
Enzymes [BR:hho01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.215  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase
     HydHO_1214
    2.1.1.216  tRNA (guanine26-N2)-dimethyltransferase
     HydHO_1214
Transfer RNA biogenesis [BR:hho03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    HydHO_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TRM Methyltransf_31 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AGG15528
UniProt: M1QJV1
Position
1132293..1133393
Genome map
AA seq 366 aa AA seqDB search
MLVKEGAVEFFIPELPEVLSKEVEVFYNPFMAVNRDFTVLILKAYSILKSKKLFIADPMS
ASGVRVLRLLKETNVVEKAFLNDIKKEAIELAQKNLEAYQNVYFFNKDANMFLLENKGFD
YIDIDPYGSPIGFLESAINALKTGGLIGITATDTASLSGSYPFKAFRRYSAKPLDSEFYH
ESALRILVKSVIEASFRLDVVLKPVFGFSYRHFLRAFFIKLKGVSKAIDISKDIAYIGYC
HSCKFRNTYTCVLDLPKFCPLCDDFFDYAGPIYIGDIYDKELLDIMKEQDFTYFTKDTIK
IFKTILEESKIKTPWFYKANIFGKGTMPKLKQILKDLDAKPTHFSPEGFKTDLDFIHIKE
YFEKWA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtaaaagaaggggcagtagagttttttataccagagcttccggaggttttatca
aaagaagtagaggttttctacaacccctttatggctgttaacagagatttcacggtgctt
atcttaaaagcctactctatactaaaatccaaaaaactttttatagctgatccaatgagc
gcttctggggttagggttttaaggcttttaaaagaaacaaacgtagtagaaaaagctttt
ttaaacgatataaaaaaagaggccatagaattagctcaaaaaaatcttgaagcttatcaa
aacgtatatttttttaacaaagatgcaaatatgtttttgttagaaaacaaaggctttgat
tatatagatatagacccttatggaagccctataggatttttagaaagcgctataaacgct
ttaaaaaccggtggtcttataggtataactgccacagatacggcatctttatctgggtca
tatccatttaaagcttttagaagatacagcgccaaacctcttgatagtgagttttatcac
gaaagtgcattgaggatacttgtaaaatctgtaatagaagcctcttttaggcttgatgtg
gtcttaaaacctgtttttggttttagttataggcactttttaagggctttttttataaaa
ttaaaaggtgtatcaaaagccatagatatatctaaagatatagcttatatagggtattgt
catagttgtaaatttagaaatacttacacatgcgttcttgatctaccaaaattttgccct
ctttgtgatgatttttttgattacgctggtcctatctatataggagatatttacgacaaa
gagcttttggatattatgaaagaacaagactttacatattttacaaaggataccataaag
atttttaaaacaattttagaagaatctaagataaaaaccccttggttttacaaagcaaat
atatttggaaaaggtacgatgccaaagctaaaacaaatattaaaagatttagatgcaaaa
cccacacactttagcccagagggttttaaaacagatttagattttatacatataaaggag
tattttgaaaaatgggcgtaa

DBGET integrated database retrieval system