KEGG   Hydrogenobaculum sp. HO: HydHO_1476Help
Entry
HydHO_1476        CDS       T02482                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
hho  Hydrogenobaculum sp. HO
Pathway
hho00130  Ubiquinone and other terpenoid-quinone biosynthesis
hho00627  Aminobenzoate degradation
hho01100  Metabolic pathways
hho01110  Biosynthesis of secondary metabolites
hho01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hho00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    HydHO_1476
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HydHO_1476
Enzymes [BR:hho01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     HydHO_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AGG15784
UniProt: M1RLP1
Position
complement(1404275..1404838)
Genome map
AA seq 187 aa AA seqDB search
MKESIALLITGASGSIYAVRTFEVLKERYDLHVVMSKTAKYVMGYETGVGEEFFKKEAHV
YDYTDFAAPISSGSFLCKFKGVLVVPCSMGTLGAVASGVAQNLIHRVCDTALKERVPLVM
LVREMPYNSIHLENMLKLTNAGAIIMSASPGFYHKPKTLEESIDFVVGKVLDTLRIDHNI
YKRWKSS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatctattgcccttcttatcaccggtgccagtggcagtatttacgctgttagg
acttttgaagtgctaaaagaacgctacgatctacatgtggtgatgtcaaaaaccgccaag
tacgtaatgggttatgaaacaggagtcggtgaggagttttttaaaaaagaagcccatgtt
tacgattatacagattttgcagctcctatatcaagcgggtcttttttatgcaagtttaaa
ggagttttggtggtgccttgttctatggggactttgggagctgtggcaagcggtgttgcc
caaaatctcattcacagagtatgcgatacagctctaaaagagagagtacctcttgttatg
cttgtaagagagatgccttacaacagtatacaccttgagaacatgctaaaactaacaaac
gccggtgccatcataatgagcgcaagccctggtttttatcataagccaaaaaccttagaa
gaaagtatagactttgtagtgggaaaagttttagataccctaaggatagatcacaacatc
tacaaaaggtggaaatcctcatga

DBGET integrated database retrieval system