KEGG   Helicobacter pylori Shi112: HPSH112_04825Help
Entry
HPSH112_04825     CDS       T02037                                 

Definition
(GenBank) geranyltranstransferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
hhp  Helicobacter pylori Shi112
Pathway
hhp00900  Terpenoid backbone biosynthesis
hhp01100  Metabolic pathways
hhp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSH112_04825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:hhp01006]
    HPSH112_04825
Enzymes [BR:hhp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     HPSH112_04825
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     HPSH112_04825
Prenyltransferases [BR:hhp01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   HPSH112_04825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AFI01164
Structure
PDB: 

Position
988700..989611
Genome map
AA seq 303 aa AA seqDB search
MNNPNLSFYHNECERFESFLNHHHLHLESFHPYLEKAFFEMVLNGGKRFRPKLFLAVLCA
LVGQKDYSNRQTEYFKIALSIECLHTYSLIHDDLPCMDNAALRRNHPTLHAKYDETTAVL
IGDALNTYSFELLSNSLLESHIIVELIKILSANGGIKGMILGQALDCYFENTPLNLEQLT
FLHEHKTAKLISASLMMGFVASGIKDEELFKWLQAFGLKMGLCFQVLDDIIDVTQDEEES
GKTTHLDGAKNSFVNLLGLEKASGYAQTLKTEVLDDLNLLKPAYPLLQENLNALLNTLFK
GKT
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccctaatttatccttttaccataatgagtgcgagcgttttgaaagcttttta
aaccaccatcatttacaccttgaaagcttccacccttatttggaaaaagccttttttgaa
atggtgcttaatgggggtaaaaggttccgccctaagctttttttagccgtgctttgcgcg
ttagtgggtcaaaaagattattctaaccggcaaacagaatattttaaaatcgctttaagc
attgaatgcttgcacacttattcgctcatccatgacgatttaccatgcatggataatgcc
gctttaaggagaaaccaccccactttacacgctaaatacgatgaaaccacagccgtttta
atcggcgatgcgctcaacacttactcttttgaattgctttcaaactctttactagaaagc
catatcattgtggaattgatcaaaatcttaagcgctaatggggggattaaaggcatgatc
ttagggcaggctttggattgctattttgaaaacacgcccttaaatttagagcagctcact
ttcttacacgagcataaaaccgctaaattgattagcgcaagcttgatgatggggtttgtt
gcaagcggtattaaagatgaagagctttttaaatggcttcaggcttttgggttaaaaatg
ggtctttgctttcaagtgttagatgatattatagatgttacacaagatgaagaagaaagc
ggtaaaaccactcatttagacggcgctaaaaacagctttgtgaatttattggggctagaa
aaggcaagcggttacgcccaaactttaaaaacagaggttttagacgatttaaacctacta
aaacccgcttatcctttattgcaagaaaatttgaacgcattattgaacactctatttaaa
ggcaagacatga

DBGET integrated database retrieval system