KEGG   Helicobacter pylori Shi112: HPSH112_05150Help
Entry
HPSH112_05150     CDS       T02037                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hhp  Helicobacter pylori Shi112
Pathway
hhp00450  Selenocompound metabolism
hhp00970  Aminoacyl-tRNA biosynthesis
hhp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HPSH112_05150
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPSH112_05150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hhp01007]
    HPSH112_05150
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hhp03016]
    HPSH112_05150
Enzymes [BR:hhp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HPSH112_05150
Amino acid related enzymes [BR:hhp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HPSH112_05150
Transfer RNA biogenesis [BR:hhp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HPSH112_05150
 Prokaryotic type
   Other AARSs
    HPSH112_05150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AFI01226
Position
complement(1058153..1060096)
Genome map
AA seq 647 aa AA seqDB search
MQKSLITTPIYYVNDVPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSAR
LRNQSPKAYADSISAIFKDQWDFFNLDYDGFIRTTDSEHQKCVQNAFEIMFEKGDIYKGV
YSGYYCVSCESYCAISKADNTNDKVLCPDCLRETTLLEEESYFFRLSAYEKPLLDFYAKN
PEAILPVYRKNEVTSFIEQGLLDLSITRTSFEWGIPLPKKMNDPKHVVYVWLDALLNYAS
ALGYLNGLDNKMAHFACARHIVGKDILRFHAIYWPAFLMSLNLPLFKQLCVHGWWTIEGV
KMSKSLGNVLDAQKIAMEYGIEELRYFLLREVPFGQDGDFSKKALIERINANLNNDLGNL
LNRLLGMAKKYFNHSLKSAKITAYYSKELEKVHQILDNANSFVPKMQLHKALEELFNVYD
FLNKLIAKEEPWVLHKNNESEKLEALLSLIANALLQSSFLLYAFMPKSAAKLASAFHAEI
TPHNYERFFKAKKLQDMILQDTEPLFSKIEKIEKAEKAREVPPEKEKKEKKEKAPLKQEN
YISIEDFKKVEIKVGLIKEAQRIEKSNKLLRLKVDLGEGCLRQIISGIALDYEPESLVDQ
MVCVVANLKPAKLMGEMSEGMILAVRDSDNLALISPTREKIAGSLIS
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatcactgatcacaacccccatttattatgtgaatgatgtcccccatattggc
catgcttatacgactttgattgcggatactctaaagaagtattacacgcttcaaggcgaa
gaagtcttttttttaaccggcaccgatgagcatgggcaaaagatcgaacaaagcgcgaga
ttgaggaatcaaagccctaaagcttacgccgatagcattagcgcgatttttaaagaccag
tgggattttttcaatttagattatgatggttttatccgcaccacagacagcgagcatcaa
aaatgcgtgcaaaacgcctttgaaatcatgtttgaaaaaggggatatttataaaggcgtt
tatagcgggtattattgcgtgagctgtgagagttattgcgcgatctctaaagcggacaac
acgaacgataaagtcttatgccctgattgcttgagagaaaccacgcttttagaagaagag
agttattttttcagattgagcgcgtatgagaagcctttattggatttttacgctaaaaac
cccgaagcgattttgcccgtttatcgtaaaaatgaggtaacttctttcattgagcagggt
ttattggatctgtctatcacgcgcacgagctttgaatggggcattcctttgcctaaaaaa
atgaacgatcctaagcatgtggtgtatgtttggctggacgctttattgaattatgcgagc
gcgttagggtatttgaatggtttagacaataaaatggcgcattttgcatgcgctaggcat
attgtgggtaaggatattttacgcttccatgccatttattggccagcttttttgatgagt
ttgaatttgcctttattcaagcagctttgcgtgcatgggtggtggacgatagagggcgtg
aaaatgagtaagagcttgggtaatgttttagacgctcaaaaaatcgctatggagtatggg
attgaggaattgcgttattttttattgcgtgaggtgccttttgggcaagatggggatttt
tctaaaaaagcgttaatagaaaggatcaatgcgaatttgaataacgatttggggaatttg
ttgaatcgcttgctaggcatggctaaaaaatatttcaatcattctctaaaaagcgcaaaa
atcaccgcttattattctaaagagctagaaaaagtgcatcaaattttagataacgctaat
tcttttgtgcctaaaatgcaattgcataaagctttagaggaattgtttaatgtttatgat
tttttaaacaaactcatcgctaaagaagagccatgggttttgcacaaaaacaacgaatca
gaaaaactagaagccttattgagcttgatcgcaaacgcgcttttgcaatcaagctttttg
ctctatgcgttcatgccaaagagcgcggctaaattagcgagcgcttttcatgcagagatt
acgccccataattacgaacgcttttttaaagctaaaaaattacaagatatgattttacaa
gacaccgagcctttattttccaaaattgagaaaattgaaaaggctgaaaaagcgagagaa
gtcccaccagaaaaagaaaaaaaagaaaaaaaagaaaaagccccactaaaacaagaaaat
tatatcagcattgaggattttaaaaaagtagagattaaagtggggcttatcaaagaagct
caaaggattgaaaaatccaataaattactgcgcttgaaagtggatttaggcgaaggttgt
ttgaggcagattatctcagggatcgctttggattatgagcctgaaagcttggtggaccaa
atggtgtgcgtggtggctaatttaaaacccgcaaagcttatgggtgaaatgagtgagggc
atgattttggcggtgcgagatagcgataatctggccttaatcagccctaccagagaaaaa
attgcaggaagtttgattagctaa

DBGET integrated database retrieval system