KEGG   Helicobacter pylori Shi112: HPSH112_05490Help
Entry
HPSH112_05490     CDS       T02037                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hhp  Helicobacter pylori Shi112
Pathway
hhp00010  Glycolysis / Gluconeogenesis
hhp00020  Citrate cycle (TCA cycle)
hhp00620  Pyruvate metabolism
hhp00640  Propanoate metabolism
hhp00650  Butanoate metabolism
hhp00680  Methane metabolism
hhp01100  Metabolic pathways
hhp01120  Microbial metabolism in diverse environments
hhp01130  Biosynthesis of antibiotics
hhp01200  Carbon metabolism
Module
hhp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH112_05490 (porD)
   00020 Citrate cycle (TCA cycle)
    HPSH112_05490 (porD)
   00620 Pyruvate metabolism
    HPSH112_05490 (porD)
   00640 Propanoate metabolism
    HPSH112_05490 (porD)
   00650 Butanoate metabolism
    HPSH112_05490 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPSH112_05490 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSH112_05490 (porD)
Enzymes [BR:hhp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSH112_05490 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_7 Fer4_2 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_4 Fer4_8 Fer4_13 Fer4_18 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AFI01291
Position
1133529..1133921
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVSKPVHNNSICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIDPASALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgca
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtgtctaagcctgtgcataacaatagcatttgcatcaac
tgctttaattgttgggtttattgcccagatgctgctattctttcaagagagggcaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgtgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgatcctgctagcgctctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcgtaa

DBGET integrated database retrieval system