KEGG   Helicobacter pylori Shi112: HPSH112_06410Help
Entry
HPSH112_06410     CDS       T02037                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hhp  Helicobacter pylori Shi112
Pathway
hhp00260  Glycine, serine and threonine metabolism
hhp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hhp01100  Metabolic pathways
hhp01110  Biosynthesis of secondary metabolites
hhp01130  Biosynthesis of antibiotics
hhp01230  Biosynthesis of amino acids
Module
hhp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hhp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSH112_06410
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSH112_06410
Enzymes [BR:hhp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSH112_06410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFI01471
Position
complement(1317739..1318920)
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEEFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIIESHSISA
GLDYPGVGPEHSYLKESARAIYESASDFEALEAFSLLCQKEGIIPALESSHALVYALKLA
QKCEEESIIVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttgaaagatgaggaattccaa
aaagaatatttccatctcttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggtggggcgcacaagactaatcaagccttagggcaagcccttttagcgaaaaaaatgggt
aaaacaaggattattgctgaaacaggcgctgggcagcatggcgtggcgacggctatcgct
tgcgcgttgttgggtttaaaatgcgtgatttttatgggggctaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgtttattaggcgctgaagtcagagaggttaattcaggg
agcgcgacgcttaaagacgctgtgaatgaagccttaagggattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccacacccttaccccacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctataggaatatttagc
gcgtttttaaacgataaagaggttaaactcataggcgtagagccggcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattatagaaagccatagcattagcgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagagagcgctcgcgcg
atttatgaaagcgcaagcgattttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccagcgctagaaagctcacacgccttagtgtatgccttaaaactcgct
caaaaatgcgaagaagaaagcatcattgtagtgaatttaagcggtcggggggataaggat
ttaagcaccgtttataacgctttaaaaggaggtttaaaatga

DBGET integrated database retrieval system