KEGG   Helicobacter pylori Shi169: HPSH169_00955Help
Entry
HPSH169_00955     CDS       T02038                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00010  Glycolysis / Gluconeogenesis
hhq00051  Fructose and mannose metabolism
hhq01100  Metabolic pathways
hhq01110  Biosynthesis of secondary metabolites
hhq01120  Microbial metabolism in diverse environments
hhq01130  Biosynthesis of antibiotics
hhq01200  Carbon metabolism
hhq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hhq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH169_00955 (tpiA)
   00051 Fructose and mannose metabolism
    HPSH169_00955 (tpiA)
   00562 Inositol phosphate metabolism
    HPSH169_00955 (tpiA)
Enzymes [BR:hhq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPSH169_00955 (tpiA)
Exosome [BR:hhq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPSH169_00955 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPSH169_00955 (tpiA)
  Exosomal proteins of melanoma cells
   HPSH169_00955 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFH98897
UniProt: A0A0E0W9G9
Structure
PDB: 

Position
186246..186950
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLEELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGVQN
AYPRDCGAFTGEITLKHLEELKINTLLIGHSERRLLLKESPSFLKEKFDFFKSKNFKIVY
CIGEELTTREKGFKAVKEFLNEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNAQNAKEILGIDSVDGLLIGSASLELESFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgctatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttagaagaattagaaaagactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagtgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcactttaaagcatttagaagaa
ctcaaaatcaacacgcttttaatagggcatagcgagaggcgattgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaaagtaaaaattttaaaattgtctat
tgcattggcgaagaattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
aacgagcaattagaaaatattgatcttaattatcccaatttagtggtggcgtatgagcct
atttgggcgattggcacaaaaaagagcgcttctttagaagatatttatctcacgcatggt
tttttaaagcaaattttaaatcaaaaaacgcccttgttgtatggggggagcgtgaatgcg
caaaacgctaaagaaattttagggattgatagcgtggatggcttgttgatcgggagcgcg
tctttggaattagaaagttttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system