KEGG   Helicobacter pylori Shi169: HPSH169_01565Help
Entry
HPSH169_01565     CDS       T02038                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hhq01100  Metabolic pathways
hhq01110  Biosynthesis of secondary metabolites
hhq01130  Biosynthesis of antibiotics
hhq01230  Biosynthesis of amino acids
Module
hhq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hhq00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSH169_01565
Enzymes [BR:hhq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPSH169_01565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS GMAP
Motif
Other DBs
NCBI-ProteinID: AFH99013
UniProt: A0A0E0WB64
Position
310847..311404
Genome map
AA seq 185 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRIISKTKDCVFVTPDEVLGKLLE
ENTRTDCVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMAEFAWRLGLSVFVETHKLDYTHLKDLGVLGVLEKVPHSQNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagaattatt
tctaaaaccaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacacccgcaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagctctttgatt
gtccatcaggatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggcatggcagaattt
gcttggcgtttgggcttaagcgtgtttgtagaaacccacaagttagactacacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaaaatcaaaaaaaa
atagtttttttagattga

DBGET integrated database retrieval system