KEGG   Helicobacter pylori Shi169: HPSH169_01780Help
Entry
HPSH169_01780     CDS       T02038                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00230  Purine metabolism
hhq01100  Metabolic pathways
Module
hhq_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hhq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HPSH169_01780 (gmk)
Enzymes [BR:hhq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HPSH169_01780 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 Thymidylate_kin AAA_17 MMR_HSR1 RNA_helicase RsgA_GTPase ABC_tran AAA_22 AAA_5 ADK dNK AAA_33 CPT AAA_29 T2SSE NTPase_1 Cytidylate_kin DUF1981 AAA_28 Zeta_toxin APS_kinase NACHT TsaE Mg_chelatase AAA_30
Motif
Other DBs
NCBI-ProteinID: AFH99056
UniProt: A0A0E0WB68
Position
complement(361629..362249)
Genome map
AA seq 206 aa AA seqDB search
MHNDFNLLILSGPSGAGKSTLTKYLQEKIPKTHFSLSTTTRKPREGEVDGLHYNFVSEEE
FKQGIEKGQFLEWAIVHNHYYGTSKIPVEKALKEGKIVIFDIDVQGHEILKKHYPNACSV
FISTKNQEILKERLLLRGTDSKETIEKRLINACKEMQCLESFDYLIINEDLEKSKEIILS
IAKTLVHRLKAFNFEKICKAWKNESL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgattttaatttactcatcctttcaggccctagcggagcgggtaaaagcacc
cttacaaagtatttgcaagaaaaaatcccaaaaacccatttttccctttccaccaccaca
cgaaagcccagagagggcgaagttgatggcttgcattacaattttgtcagcgaagaagaa
ttcaaacaaggcatagaaaaggggcagtttttagaatgggcaatcgtgcataaccactat
tatggcacttctaaaatccctgtagaaaaagccttaaaagagggcaaaatcgtcattttt
gatattgatgtgcaagggcatgagatccttaaaaagcattaccccaacgcatgctctgtg
tttattagcaccaaaaaccaagagattttaaaagagcgcttgcttttaagagggacggat
tctaaagagacgatagaaaaacgcttgatcaacgcttgtaaggaaatgcagtgcttggag
agctttgattacctcatcatcaatgaagatttggaaaaatccaaagaaatcatcttaagc
atcgcaaaaactttagtccatcgcttaaaagcgtttaattttgaaaaaatatgcaaggct
tggaaaaacgaatccttataa

DBGET integrated database retrieval system