KEGG   Helicobacter pylori Shi169: HPSH169_03550Help
Entry
HPSH169_03550     CDS       T02038                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00071  Fatty acid degradation
hhq00072  Synthesis and degradation of ketone bodies
hhq00280  Valine, leucine and isoleucine degradation
hhq00310  Lysine degradation
hhq00362  Benzoate degradation
hhq00380  Tryptophan metabolism
hhq00620  Pyruvate metabolism
hhq00630  Glyoxylate and dicarboxylate metabolism
hhq00640  Propanoate metabolism
hhq00650  Butanoate metabolism
hhq00900  Terpenoid backbone biosynthesis
hhq01100  Metabolic pathways
hhq01110  Biosynthesis of secondary metabolites
hhq01120  Microbial metabolism in diverse environments
hhq01130  Biosynthesis of antibiotics
hhq01200  Carbon metabolism
hhq01212  Fatty acid metabolism
hhq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hhq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPSH169_03550
   00630 Glyoxylate and dicarboxylate metabolism
    HPSH169_03550
   00640 Propanoate metabolism
    HPSH169_03550
   00650 Butanoate metabolism
    HPSH169_03550
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPSH169_03550
   00072 Synthesis and degradation of ketone bodies
    HPSH169_03550
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPSH169_03550
   00310 Lysine degradation
    HPSH169_03550
   00380 Tryptophan metabolism
    HPSH169_03550
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSH169_03550
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPSH169_03550
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPSH169_03550
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhq04147]
    HPSH169_03550
Enzymes [BR:hhq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPSH169_03550
Exosome [BR:hhq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPSH169_03550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFH99406
UniProt: A0A0E0WC63
Position
730396..731571
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAIGSFLGSLKSVGAREMGTVVLKDALKASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSM
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKVQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDIDLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGSGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctatagggagttttttaggctct
ctaaagagcgtgggtgctagagaaatgggtactgtcgtgcttaaagacgctttgaaggcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccagacagatccaactggacgctggcatccctaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagcatg
gcaccctatctgtcgtttgacatgcgagacgggaaaagaatggggaatgcgaacatgata
gactccatgattcatgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggtgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggtgcgagtattatcattttatgcagcgct
caaaaagtgcaaaaattggggttaaaaacaatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaacgacatcgatctttttgaactcaatgaagccttcgccgcg
caaagcatagccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggtgcgatagccattggccaccctattggcgcaagcggcgctaggatcttggtaacttta
ttgcatgaaatgaaaagaagcggtcatggcgtgggttgcgcgtcattgtgtgtgggcagc
ggacaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system