KEGG   Helicobacter pylori Shi169: HPSH169_04395Help
Entry
HPSH169_04395     CDS       T02038                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00540  Lipopolysaccharide biosynthesis
hhq01100  Metabolic pathways
Module
hhq_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hhq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPSH169_04395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hhq01005]
    HPSH169_04395
Enzymes [BR:hhq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     HPSH169_04395
Lipopolysaccharide biosynthesis proteins [BR:hhq01005]
 Unusual sugar
  HPSH169_04395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR
Motif
Other DBs
NCBI-ProteinID: AFH99567
UniProt: A0A0E0WB87
Structure
PDB: 

Position
complement(899729..900721)
Genome map
AA seq 330 aa AA seqDB search
MRYIDDELENQTILITGGAGFVGSNLAFYFQENHPKAKVVVLDKFRSNTLFSNKHPSSLG
HFKNLIGFNGEVIVADINNPLDLRRLEKLHFDYLFHQAAVSDTTMLDQELVMKTNYQAFL
NLLEIARSKKAKVIHASSAGVYGNTKAPNVVGKNESPENVYGFSKLCMDEFVLSHSNDNI
QVGLRYFNVYGPREFYKEKTASMVLQLALGIMAFKEVKLFEFGEQLRDFVYIEDVIQANV
KAMKAQKSGVYNVGYSQARSYNEIVSILKEHLGDFKVTYIKNPYAFFQNHTQAHIEPTIL
DLDYTPLYDLESGIKDYLPHIHAIFKEHCA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatattgatgatgaattagaaaatcaaacgattttaatcaccggtggggctggc
tttgtaggcagtaatctggccttttattttcaagagaaccaccctaaagctaaagtggtg
gttttggataagtttcgcagtaacacgcttttcagtaataagcaccccagttccttaggg
cattttaagaatttaatcggttttaatggtgaggtgattgtagctgatattaataacccc
ttagatttaaggcgtttagaaaaattgcattttgattatttgttccaccaagccgctgtc
tctgatacgaccatgctggatcaagaattagtgatgaagaccaactatcaggctttttta
aaccttttagaaatcgctcgctcaaaaaaagctaaagtgattcacgcttcttcagcgggc
gtttatggcaacaccaaagcccccaatgtggtaggcaaaaacgaaagccctgaaaatgtt
tatggcttttccaagctttgcatggacgaatttgtcctctctcattcaaacgacaatatt
caagtgggcttaaggtattttaatgtctatgggcctagggaattttataaagaaaaaacc
gcctctatggttttgcaactcgccttaggcataatggcgtttaaggaagtcaagcttttt
gaatttggcgagcaattaagggattttgtctatattgaagatgtgattcaagcgaatgtg
aaagcgatgaaagctcaaaaaagcggggtttataatgtgggttattcccaagccagaagt
tataatgaaatagttagcattttaaaagagcatttaggggattttaaagtaacttatatc
aaaaacccttatgctttcttccaaaatcacacccaagcgcatattgaacccactattttg
gatttagactacacccctttatacgatttagaaagtggtattaaagattatttgcctcat
atccatgcgatttttaaagaacattgcgcatga

DBGET integrated database retrieval system