KEGG   Helicobacter pylori Shi169: HPSH169_05475Help
Entry
HPSH169_05475     CDS       T02038                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00010  Glycolysis / Gluconeogenesis
hhq00020  Citrate cycle (TCA cycle)
hhq00620  Pyruvate metabolism
hhq00640  Propanoate metabolism
hhq00650  Butanoate metabolism
hhq00680  Methane metabolism
hhq01100  Metabolic pathways
hhq01120  Microbial metabolism in diverse environments
hhq01130  Biosynthesis of antibiotics
hhq01200  Carbon metabolism
Module
hhq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH169_05475 (porD)
   00020 Citrate cycle (TCA cycle)
    HPSH169_05475 (porD)
   00620 Pyruvate metabolism
    HPSH169_05475 (porD)
   00640 Propanoate metabolism
    HPSH169_05475 (porD)
   00650 Butanoate metabolism
    HPSH169_05475 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPSH169_05475 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSH169_05475 (porD)
Enzymes [BR:hhq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSH169_05475 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_7 Fer4_2 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_4 Fer4_8 Fer4_13 Fer4_18 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AFH99761
UniProt: A0A0E0WD59
Position
1133109..1133501
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVSKPVHNNSICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIDPASALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgcg
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtgtctaagcctgtgcataacaatagcatttgcatcaac
tgctttaattgttgggtttattgcccagatgctgctattctttcaagagagggcaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgtgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgatcctgctagcgctctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcgtaa

DBGET integrated database retrieval system