KEGG   Helicobacter pylori Shi169: HPSH169_06080Help
Entry
HPSH169_06080     CDS       T02038                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00860  Porphyrin and chlorophyll metabolism
hhq01100  Metabolic pathways
hhq01110  Biosynthesis of secondary metabolites
hhq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPSH169_06080 (hemD)
Enzymes [BR:hhq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HPSH169_06080 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Peptidase_S41
Motif
Other DBs
NCBI-ProteinID: AFH99878
UniProt: A0A0E0WDP4
Structure
PDB: 

Position
1259888..1260568
Genome map
AA seq 226 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNEFCYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLK
ILQNIPAYALSEPTAKTLQDHHFKVAFIGEKAHGKEFVQEILPLLEKKSVLYLRAKEIAS
SLDTILLEHGIDFKQAVVYENKLKHLTLSEQNALKPKEKSILIFTAISHAKAFLHYFEFL
ENYTAISIGNTTALYLQEQGIQSYSAKKPSLEACLELALSLRVKEC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatttta
aatgaattttgctactatcccttagaattagatccaaccccttttaacgcccttattttc
acctctaaaaatgcggtgttttccttgctagaaactctaaaaaacagccccaaactcaaa
attttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaaccttacaagat
caccattttaaagtcgcctttataggggaaaaagcccatggcaaagagttcgttcaagaa
atccttcctttattggaaaaaaaaagcgttttgtatctcagggcaaaagaaattgcttct
tctttagacaccattcttttagagcatggcattgatttcaagcaagccgttgtttatgaa
aacaagctcaaacatttaaccttaagcgaacaaaacgccctaaaacccaaagaaaagagc
attcttatttttaccgccataagccatgcaaaagccttcttgcactattttgaattttta
gaaaattacaccgctataagcattggcaacacgaccgctctttatttgcaagagcaaggc
attcaaagctatagcgccaaaaagccctccttagaagcgtgtttagaactggctttgagt
ttgagggttaaggaatgttaa

DBGET integrated database retrieval system