KEGG   Helicobacter pylori Shi169: HPSH169_07085Help
Entry
HPSH169_07085     CDS       T02038                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00900  Terpenoid backbone biosynthesis
hhq01100  Metabolic pathways
hhq01110  Biosynthesis of secondary metabolites
hhq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hhq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSH169_07085
Enzymes [BR:hhq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPSH169_07085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFI00074
UniProt: A0A0E0WE66
Position
1443116..1443919
Genome map
AA seq 267 aa AA seqDB search
MHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKFKDIISVKSALSFSLKGDFDCPLE
ENSLFKALQILKNFLKSKNFSHSAIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSLEELYSMGSLVGADTNFFISQHKSTNATSYGEVIENFEEEPLENRLEIYAPN
HVFCSTKAIYQAYKPETCFSQAKEWLKKPSLECLKTCDRNELNDLLKPALLTNQALRGIE
SELGKEWFFSGSGSAFFRLKPALKGGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcctttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaagaa
ggggcttatcataagctcatttctcgcatgtgtttggtcaaagataaattcaaagatatt
atcagcgtcaaaagcgcgctttccttttcgctaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaatttc
tctcattctgccatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccggattaggcggtgggagcgctgatgctggggggctattgtatcatttgaat
caaatttttgactggcgtttgagtttagaagagctttatagcatgggatctttagtgggt
gcagacaccaactttttcatctcgcaacacaaaagcactaacgccacttcttatggcgaa
gttattgaaaattttgaagaagagcctttagaaaatcgcttagaaatctatgcaccaaac
catgttttttgcagcaccaaagccatctatcaagcctataaacctgaaacttgtttttct
caagctaaagagtggcttaaaaaaccgagtttagaatgcctaaagacttgcgacagaaac
gaattaaacgatcttttaaaaccggctttactcactaaccaagccttaagaggtatagaa
agcgaactgggcaaggagtggttttttagcgggagcgggagcgcgttttttaggctaaag
cctgcgttaaaagggggcgaatga

DBGET integrated database retrieval system