KEGG   Helicobacter pylori Shi417: HPSH417_03305Help
Entry
HPSH417_03305     CDS       T02039                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hhr  Helicobacter pylori Shi417
Pathway
hhr00071  Fatty acid degradation
hhr00072  Synthesis and degradation of ketone bodies
hhr00280  Valine, leucine and isoleucine degradation
hhr00310  Lysine degradation
hhr00362  Benzoate degradation
hhr00380  Tryptophan metabolism
hhr00620  Pyruvate metabolism
hhr00630  Glyoxylate and dicarboxylate metabolism
hhr00640  Propanoate metabolism
hhr00650  Butanoate metabolism
hhr00900  Terpenoid backbone biosynthesis
hhr01100  Metabolic pathways
hhr01110  Biosynthesis of secondary metabolites
hhr01120  Microbial metabolism in diverse environments
hhr01130  Biosynthesis of antibiotics
hhr01200  Carbon metabolism
hhr01212  Fatty acid metabolism
hhr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hhr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPSH417_03305
   00630 Glyoxylate and dicarboxylate metabolism
    HPSH417_03305
   00640 Propanoate metabolism
    HPSH417_03305
   00650 Butanoate metabolism
    HPSH417_03305
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPSH417_03305
   00072 Synthesis and degradation of ketone bodies
    HPSH417_03305
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPSH417_03305
   00310 Lysine degradation
    HPSH417_03305
   00380 Tryptophan metabolism
    HPSH417_03305
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSH417_03305
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPSH417_03305
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPSH417_03305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhr04147]
    HPSH417_03305
Enzymes [BR:hhr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPSH417_03305
Exosome [BR:hhr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPSH417_03305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFH97812
Position
682717..683892
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSTVGSFLGSLKSVGAREMGTVVLKDALKASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNGRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYRISREEQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKAQKLGLKTMAAIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGVIAIGHPIGASGARILVTL
LHEMKRSAQSVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcactgtagggagttttttaggctct
ctaaagagcgtgggtgctagagaaatgggtactgtcgtgcttaaagacgctttgaaggcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccagacagatccaactggacgctggcatccctaatggcaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtatgcggtggcgtggaaaacatgagtgca
gcgccttatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gactccatgatccatgatggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccgcatcagccgagaagagcaagatgctttcgcactc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaggacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagatggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaaacaatggcggctatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgagctcaatgaagctttcgccgcg
caaagcatagccgtgttaaaagagcttgaattaaaccctaatatcgtaaatgtgaatgga
ggcgtgatagccattggccaccctattggtgcaagcggcgctaggatcttagtaacttta
ttgcatgaaatgaaaagaagcgctcaaagcgtgggctgcgcgtcattgtgtgtgggtggc
ggtcaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system