KEGG   Helicobacter pylori Shi417: HPSH417_05235Help
Entry
HPSH417_05235     CDS       T02039                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hhr  Helicobacter pylori Shi417
Pathway
hhr00010  Glycolysis / Gluconeogenesis
hhr00020  Citrate cycle (TCA cycle)
hhr00620  Pyruvate metabolism
hhr00640  Propanoate metabolism
hhr00650  Butanoate metabolism
hhr00680  Methane metabolism
hhr01100  Metabolic pathways
hhr01120  Microbial metabolism in diverse environments
hhr01130  Biosynthesis of antibiotics
hhr01200  Carbon metabolism
Module
hhr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH417_05235
   00020 Citrate cycle (TCA cycle)
    HPSH417_05235
   00620 Pyruvate metabolism
    HPSH417_05235
   00640 Propanoate metabolism
    HPSH417_05235
   00650 Butanoate metabolism
    HPSH417_05235
  Energy metabolism
   00680 Methane metabolism
    HPSH417_05235
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSH417_05235
Enzymes [BR:hhr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSH417_05235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AFH98179
Position
1093954..1094514
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDNEPILN
HERFMQPDYVLVIDPGLVFIENIFADEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcacgagcgggtcaaggcgctatcaccggcgctaaaggg
ctggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggagctgctatgatggcttataaccgcattgataatgagcctattttaaac
catgaacgcttcatgcagcctgattatgtgctggtgattgatccgggtttggttttcatt
gaaaatatcttcgctgatgaaaaagaagacacgacctatatcatcaccagctatcttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccccatccctaacacgcccatgctaggg
gcgttaatgaaagtgtctggcatgcttgaaatcggggcttttaaagaagcttttaagaaa
gttttgggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system