KEGG   Helicobacter pylori Shi417: HPSH417_06455Help
Entry
HPSH417_06455     CDS       T02039                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hhr  Helicobacter pylori Shi417
Pathway
hhr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hhr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HPSH417_06455 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hhr03011]
    HPSH417_06455 (rplV)
Ribosome [BR:hhr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HPSH417_06455 (rplV)
  Bacteria
    HPSH417_06455 (rplV)
  Archaea
    HPSH417_06455 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 ptaRNA1_toxin
Motif
Other DBs
NCBI-ProteinID: AFH98411
Position
complement(1333201..1333569)
Genome map
AA seq 122 aa AA seqDB search
MSKALLKFVRLSPTKARLIARQIQGMNAELAIASLEFTPNKAARVLSKVVASAVANGSLD
AKSALIVSCRVDAGPVLRRSIPRAKGRATAIRKPTSHVFVEVAEGKEMKSSKSHKKNQAE
GK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcgttattaaaatttgtgcggttatctcctactaaagccagattgattgca
agacagattcaaggcatgaacgctgaattagcgatcgctagtttggaatttacgcccaat
aaagcggctagagtgctttcaaaagtggtggcttctgcggtcgctaacggctctttagac
gccaagagcgctctgattgtttcttgcagagtggatgctggccctgtgcttaggcgctcc
attccaagggctaaaggcagagccacagccattagaaagccaacatctcatgtattcgta
gaagtagcagaagggaaagaaatgaaatcttctaaaagccataaaaaaaatcaagcagaa
ggtaagtag

DBGET integrated database retrieval system