KEGG   Helicobacter pylori Shi417: HPSH417_07680Help
Entry
HPSH417_07680     CDS       T02039                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hhr  Helicobacter pylori Shi417
Pathway
hhr00220  Arginine biosynthesis
hhr00330  Arginine and proline metabolism
hhr01100  Metabolic pathways
hhr01110  Biosynthesis of secondary metabolites
hhr01130  Biosynthesis of antibiotics
hhr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hhr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HPSH417_07680
   00330 Arginine and proline metabolism
    HPSH417_07680
Enzymes [BR:hhr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPSH417_07680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFH98650
Structure
PDB: 

Position
complement(1597271..1598239)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTIVQEQCVLYKEFRYAKNFE
DYYLFCKENLIPCMREVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGALEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKESLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLKAVEVTEYNPTVSAKHTNEEERQVLE
ILDLIINSCKIKDKKPSFIMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagctttaagcgcaacgcatggcgatgtgattaaaggcatgcaa
acgatcgttcaagagcagtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgcgagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaagacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttgggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctctgctctttggggttagaaaagggagcgttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagtgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaatcattaaaagcggtggatattatttatctcagtttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgcgaaaataacgggctgagttttgatgagctcaag
caattactgggcttgcttttagaaagctttaaagacagattaaaagccgttgaggtaacc
gaatacaaccccacggtgagcgcaaaacacaccaacgaagaagaaaggcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagataagaagccatcttttataatg
agtcgctga

DBGET integrated database retrieval system