KEGG   Candidatus Pantoea carbekii: HHS_05700Help
Entry
HHS_05700         CDS       T02865                                 

Gene name
gnd
Definition
(GenBank) Gnd protein
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
hhs  Candidatus Pantoea carbekii
Pathway
hhs00030  Pentose phosphate pathway
hhs00480  Glutathione metabolism
hhs01100  Metabolic pathways
hhs01110  Biosynthesis of secondary metabolites
hhs01120  Microbial metabolism in diverse environments
hhs01130  Biosynthesis of antibiotics
hhs01200  Carbon metabolism
Module
hhs_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hhs_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:hhs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HHS_05700 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HHS_05700 (gnd)
Enzymes [BR:hhs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     HHS_05700 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     HHS_05700 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 2-Hacid_dh_C Shikimate_DH NAD_Gly3P_dh_N F420_oxidored 3HCDH_N NAD_binding_11
Motif
Other DBs
NCBI-ProteinID: BAO00540
UniProt: U3U6F6
Position
783195..784613
Genome map
AA seq 472 aa AA seqDB search
MSKQQIGVIGMAVMGRNLALNIESRGYAVSIFNRSRKKTDEIIDQNRYKKLIPYYSIQEF
VSSLERPRCILLMVQAGDATDNLITSLIPYLNKNDILIDGGNSFYKDTIRRSKDICKQGF
NFIGAGISGGEEGAMKGPSIMPGGTKESYELVAVIFNKIAARADNGEACVTYIGPDGAGH
YVKMVHNGIEYSDMQLISEVYSLLKSALGLKNMELAQIFSDWNNGELNSYLIDITKNIFL
KKDENGKHLIDVILDKAAEKGTGKWASHNALELGEPLSIITESVFARYLSCLKSQRVIAS
KLFIGPDHNKILISNKEEFIEKIRRALYLSKILSYAQGFSQLRAASKYYNWNLNYANIAK
IFRAGCIIRAQFLQKITDTYIEDCNIPNLLLGNYFKNIANQYQQSLREIVAYAVQIGIPM
PTFSASIAYYDSYRSAFLPANLIQAQRDYFGAHTYRRTDKEGIFHTEWLNCS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcaacaaatcggtgtgataggtatggcagtaatgggtcgtaatttagctctt
aatattgaaagtcgaggctatgcagtttctatttttaatcgttctcgcaaaaaaaccgac
gaaattattgatcaaaatcgatataaaaaacttattccttattattctatccaagaattt
gtcagttcattggaaagacctcgttgtattttattaatggttcaagcaggtgatgcaaca
gataatcttataacttcgcttatcccatatcttaataaaaatgatattttaattgatggt
ggcaatagcttctataaagacactattcgtcgcagtaaagatatctgcaaacaaggtttt
aacttcattggcgctggtatatcagggggggaagaaggagcaatgaaaggcccttctatt
atgccaggtggtacaaaagaatcttatgaactagttgcagtaatttttaataaaattgct
gctcgagcagataatggagaagcttgtgttacctatataggtccagatggtgctggtcat
tacgtaaaaatggtccataatggtattgaatatagcgatatgcagcttatttcagaagta
tattctctactcaagagtgcacttggtttaaaaaatatggaattagcacaaatttttagt
gattggaataatggcgaattaaatagttatttaattgatattactaaaaatatcttttta
aaaaaagatgaaaacggcaaacatttaattgatgtgattttagataaagcagcagagaaa
ggtacaggcaaatgggctagtcacaatgctcttgagcttggggaaccactgtcaattatt
actgaatctgtatttgctcgttatctttcctgtttaaaatctcagcgtgtaattgcatct
aaattattcattggtccagatcacaataaaattctaataagtaataaagaggaattcatt
gaaaaaatacgtcgtgcattatatctaagtaaaattttgtcttatgcgcagggattttct
caattgcgtgccgcttcaaaatactataattggaatttgaattatgctaatattgcaaaa
attttccgtgctggttgtattattcgagcacaatttttgcaaaaaattacagatacttat
atagaagattgtaatatacctaatttactactaggcaattattttaaaaatatcgctaat
caataccagcaatcattacgtgaaatagtagcatatgcagtacaaattggtattccaatg
ccaaccttttctgcatcaattgcctattacgatagttatcgctcagcatttttaccagct
aatctgattcaagctcaacgtgactattttggcgcacacacttatagacgcactgacaaa
gaagggatattccatacggaatggctgaattgttcataa

DBGET integrated database retrieval system