KEGG   Haloarchaeon HSR6: HSR6_0025Help
Entry
HSR6_0025         CDS       T04550                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hhsr  Haloarchaeon HSR6
Brite
KEGG Orthology (KO) [BR:hhsr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HSR6_0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2304
Motif
Other DBs
NCBI-ProteinID: APE94501
UniProt: A0A1D8S1L6
Position
22893..24068
Genome map
AA seq 391 aa AA seqDB search
MIEILLLIGIGVSLFVGFNIGGATTGPAFGPAVGSDAISKTGAAALMSIFFFIGAWTIGR
RVVDTLGSELITSTTVFTMESSIVVLFFIGGALFVGNYFGVPASTSMTAVGAIAGLGVAT
GELDWAVMGEIAVWWIVAPIVGFWVSGMIGRYLYPRINRWVAIDNTPGALWELDRSGAIP
QPTTGPNTTRRELTGAIVVIVIGSLMAFSSGTSNIANAIAPLVGAGVDMNMMIILGGVAV
AVGAFTIARRTLDTLGNDITDLPLTAAIIVAIVSSAIVIGLSAIGIPASFVIIATMSIVG
LGWGRATRPATIPEVVHGEGTEGVSVGALAAEEPGEELPPIGEEDPADIPSAADLFDPST
TGRVIVMQNVVPLLSTVGAYVTFTLLFTLVW
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaatcctccttctcattggaatcggcgtctcgctattcgtcgggttcaacatc
ggcggggccaccactggcccggcattcggcccggcggtcggttcggacgccatctcgaag
accggggccgcggcgctcatgtcgatattcttcttcatcggcgcgtggaccatcggccgt
cgagtcgtggacacgctgggctcggaactcatcaccagcacaaccgtgttcacgatggaa
tcgagtatcgtcgtcctctttttcatcggcggcgcgctgttcgtcgggaactacttcggg
gtcccggcctcgacctcgatgacggccgtcggcgcgatcgccgggctgggcgtcgccacc
ggcgaactggactgggcggtcatgggcgagatcgccgtctggtggatcgtcgccccgatc
gtcggcttctgggtctccgggatgatcggccgctatctctatccccggatcaatcgctgg
gtggcgatcgacaacacgcccggcgcgctctgggaactggatcgctccggggccatcccc
cagcccacgaccgggccgaacacgacccgccgggagttgaccggcgcgatcgtggtgatc
gtgattggcagcctgatggccttctcctcgggcacctcgaacatcgcgaacgccatcgca
cccctcgtgggggccggcgtggacatgaacatgatgatcattctgggcggggtcgcagtc
gcggtcggggcctttacgatcgcccgacggaccctcgacacgctcgggaacgacatcacc
gacctcccgctcacggcggcgatcatcgtggcgatcgtctcctcggccatcgtgatcggg
ctctcggcgatcggcatcccggcctctttcgtgatcatcgcgacgatgtccatcgtcggt
ctgggctgggggcgagcgacccgccccgcgacgatcccggaggtcgttcacggcgagggg
accgagggggtctccgtgggcgcgcttgcggccgaagagccgggcgaggaactcccgccg
atcggcgaggaggaccccgcggacatcccgtcggctgcagacctgttcgatccctccacg
accggccgtgtgatcgtcatgcaaaacgtggttccgctgctctccaccgtgggcgcgtac
gtgactttcacgcttctgttcacgctggtctggtga

DBGET integrated database retrieval system