KEGG   Haloarchaeon HSR6: HSR6_1839Help
Entry
HSR6_1839         CDS       T04550                                 

Definition
(GenBank) NAD+ dependent glucose-6-phosphate dehydrogenase
  KO
K19243  NAD+ dependent glucose-6-phosphate dehydrogenase [EC:1.1.1.388]
Organism
hhsr  Haloarchaeon HSR6
Pathway
hhsr00030  Pentose phosphate pathway
hhsr01100  Metabolic pathways
hhsr01110  Biosynthesis of secondary metabolites
hhsr01120  Microbial metabolism in diverse environments
hhsr01130  Biosynthesis of antibiotics
hhsr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HSR6_1839
Enzymes [BR:hhsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.388  glucose-6-phosphate dehydrogenase (NAD+)
     HSR6_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_4 NAD_binding_10 RmlD_sub_bind DUF3986 NmrA
Motif
Other DBs
NCBI-ProteinID: APE96275
UniProt: A0A1D8S6E9
Position
1807544..1808308
Genome map
AA seq 254 aa AA seqDB search
MDEPVLLTGAAGRVGTAIREGIGEAHEFRLLDREPPTGPVDHELYVGDITDRELLEDAME
DVAVVIHLAGDPRTDAPWESVLRNNIDGTQTVFEVAVEQDVEKVVFASSNHAVGHYETER
KPDIYRTEEEFRLDGTELPRPSNLYGVSKATGEILGRYYHDEYGISVLNVRIGNLTKEHP
PRNYERGQAMWLSHRDCAHLFDRAIEAEYGYEIVYGISDNDRKYYSIERAREILAYDPQD
NSAEYTFDGEPKTD
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaccggtcctgttgacgggagctgccgggcgggtgggcaccgcgatccgggag
ggcatcggcgaggctcacgagttccggctgctcgatcgcgagccgcccaccggccccgtc
gaccacgaactctacgtcggggacatcaccgacagggagctcctcgaagacgccatggaa
gacgtggccgtcgtcatccacctggccggagacccccggactgacgccccctgggagagt
gtgctccggaacaacatcgacggcacccagaccgtcttcgaggtcgccgtcgaacaggac
gtggaaaaggtggtctttgcctcctcgaaccacgcggtcggtcactacgaaaccgaacga
aaacccgacatctatcgcactgaggaggagttccgcctggatggcaccgaactcccccgg
ccgagcaacctctacggcgtgagcaaggccaccggcgagattttgggtcggtactaccac
gacgagtacggcatctcggtgttgaacgtccggatcgggaacctcaccaaggagcacccc
ccacgcaactacgagcgcgggcaggcgatgtggctctcccaccgggactgtgcccacctc
ttcgatcgggccatcgaggccgagtacggctacgagatcgtctatggcatctcggacaac
gatcgcaagtactactccatcgagcgcgcccgagagattctggcgtatgacccccaggac
aactccgcggagtacaccttcgacggcgagccgaaaacggactga

DBGET integrated database retrieval system