KEGG   Herbaspirillum hiltneri: F506_00515Help
Entry
F506_00515        CDS       T04039                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
hht  Herbaspirillum hiltneri
Pathway
hht00471  D-Glutamine and D-glutamate metabolism
hht00550  Peptidoglycan biosynthesis
hht01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hht00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    F506_00515
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    F506_00515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hht01011]
    F506_00515
Enzymes [BR:hht01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     F506_00515
Peptidoglycan biosynthesis and degradation proteins [BR:hht01011]
 Precursor biosynthesis
  Amino acid ligase
   F506_00515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7 APG6_N
Motif
Other DBs
NCBI-ProteinID: AKZ61345
Position
121293..123380
Genome map
AA seq 695 aa AA seqDB search
MNYVEKHALVLGLGESGLAMAQWLVHCGARVRVADTRDEQAVTERLAALRAASGDIEFVG
GRALSADLLDGVDFVAVSPGLAPGRELAAVSAAANERNIPLWGEMELFAQALAALREGRA
YAPKVLAITGTNGKTTVTTLTGMLCRRAGLTTKVAGNISPAVLDVLRQALIDDDAHAKVV
AEQIRIEQEAAALQAEADAVEAEKLAAEAARQAAIEAAEAARKAAEEAELAAAAEAAAAQ
LELREQEEAAELQAAIDEAANELKEAGAPATQAARMEGDAMLSVDASAVPDAESDAESDV
ESDAEAAAIVGEVAPELDAQAQAEQGDPAGEAAPPQAGSADEEDTSPLQLELPPPEPEKV
YTGILPQAWVLELSSFQLHSTHSLQPSAATVLNVTQDHLDWHGDMEAYAADKAKIFGDNT
VRVLNRDDPLVMQMTRPGANISSFGMSEPTKAGDFGLVDENGMLWLANAVAIEDEEKPEG
RRRKKDPKEVAEQPFQLKRLMPADALRIRGLHNALNGLAALALCRAVDLPLAPLLHGLRE
YTGEPHRVELVTTIQDVEYYDDSKGTNVGATVAALNGLGHGGTPNRLLLIAGGEGKGQDF
APLAEPLSKYGRAVFLIGRDAGAIRSAVADSGIELIDCATLEEAVEKAGAMARGGDAVLL
SPACASFDMFRNYAHRAEVFVNAVRELALSRGEVM
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgtcgagaaacacgctctggtgctcggactcggtgaatccggtctggcgatg
gcgcaatggctggtccattgcggcgcgcgcgtgcgtgtggccgacacccgcgacgagcag
gccgtgactgagcgcctggcggcattgcgcgcggcgtccggcgatatcgaatttgtcggc
ggccgggccttgtcggccgatttgttggacggcgtcgacttcgtcgccgtcagtcccggc
ctggcacccgggcgcgaactggcggcggtgtccgccgccgcgaacgaacgcaacatcccg
ctgtggggtgaaatggaattgttcgcgcaagccctggcggcgttgcgcgaaggacgagct
tatgcaccgaaagtgttggcgatcaccggcaccaacggcaagaccaccgtcaccaccctg
accggcatgctgtgccgccgcgcaggcctgactaccaaggtcgcgggcaatatcagcccg
gcagtgctggacgtcttgcgtcaggcgctgatcgatgatgacgcgcacgccaaggtagtt
gcagaacaaatacggatcgagcaggaagccgccgccttgcaagccgaggccgatgcggtg
gaagctgaaaagcttgctgcggaggctgcgcgacaagccgccatcgaagcagccgaagct
gcacggaaggcagcggaagaagccgaactcgccgcagcagctgaagcagccgcagcccag
ctggaattgcgtgaacaggaagaagccgctgaactgcaggccgccatcgatgaagccgcg
aatgagttgaaggaagccggtgcaccggcgacccaggccgcccggatggaaggcgatgcg
atgctgagtgtcgacgcctcggcagtgccggatgctgaatcagacgcagaatcagacgta
gaatcggacgctgaagctgccgcgatcgttggcgaagtagcgccggagctcgacgcgcaa
gcacaggcagagcagggcgacccagcaggagaagccgcaccgcctcaagccggatctgcc
gacgaagaagacacgagcccgttgcagctcgaactgccgccgcccgaacccgaaaaagtc
tacaccggcatcctgccgcaagcctgggtgctggagctgtcgagcttccagctgcactcc
acgcacagcctgcagccaagcgccgcgaccgtgctcaacgtcacgcaggatcatctcgac
tggcacggcgatatggaagcctacgccgccgacaaggcgaagatttttggcgacaacacc
gtgcgcgtgctcaaccgcgacgatccgttggtcatgcagatgaccaggccgggcgcgaac
atatctagttttggcatgagtgagccgaccaaggccggcgacttcggcctggtcgatgaa
aacggcatgctgtggctggccaacgccgtggccatcgaagacgaagaaaaacccgaaggc
cgccgccgcaagaaggaccccaaggaagtggccgagcagccgttccagcttaagcgcctg
atgcccgccgacgccttgcgcattcgtggcttgcacaatgcgctcaacggcctggccgcg
ctggcgctgtgccgcgccgtcgacttgccgttggcgccgctgctgcacggcctgcgcgaa
tataccggcgaaccgcaccgtgtcgaactggtcacgaccatccaggacgtggaatattat
gacgacagcaagggcaccaatgtcggcgccaccgtggccgcgctcaatggcctcggtcat
ggcggcacgccgaatcgcctgctgttgattgccggcggtgaaggcaagggacaggatttc
gcgccgctggccgaaccgctgtcgaagtacggtcgcgccgtgttcctgattggccgcgat
gccggcgccatccgcagcgccgtggccgacagcggcatcgaactgattgactgcgcgacg
ctggaagaagccgtcgaaaaagccggcgccatggcgcgcggtggcgatgccgtgctgctg
tcgccggcgtgcgccagtttcgacatgttccgcaactatgcgcatcgcgccgaagttttc
gttaatgccgtgcgtgagttggccttgtcgcgcggtgaggtaatgtga

DBGET integrated database retrieval system