KEGG   Herbaspirillum hiltneri: F506_08715Help
Entry
F506_08715        CDS       T04039                                 

Definition
(GenBank) phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
hht  Herbaspirillum hiltneri
Brite
KEGG Orthology (KO) [BR:hht00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    F506_08715
Enzymes [BR:hht01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     F506_08715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AKZ62747
UniProt: A0A0K2BCK3
Position
1937741..1938577
Genome map
AA seq 278 aa AA seqDB search
MLNVDMHCHSNFSDGLLPPEEVAARAKANGVDVWALTDHDEVGGIAIARKAAQDLGLRYI
PGVEISVTWAGQTVHIVGLRIDETNAALVQGLAATRNGRERRAREIAAQLAVAGIPDAFD
GALKHVGNPDLISRTHFARYIVETGRCADTKEVFRNYLCEGKPGYVPHRWATLRESVEWI
CGAGGVAVIAHPGRYSYSELEFGALFDEFKQYGGTGIEVITGSHTPDQYEEYARVARRFG
FLASIGSDFHGPGESHVDLGALPPLPSGLTPVWHDWGL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacgtcgatatgcactgccattccaacttctccgacggtttgctgccgccggaa
gaggtggctgcgcgcgccaaggccaacggcgtcgatgtctgggcgctgaccgaccacgac
gaagtcggcggcatcgccatcgcccgcaaggcggcacaagacctgggcctgcgctatatc
ccgggcgtcgagatttcagtgacttgggccggccagaccgtgcatatcgtcggtctgcgc
atcgacgagaccaatgctgcgctggtacagggactcgctgccacgcgcaacggccgcgag
cggcgcgcacgcgagatcgccgcccaacttgccgtcgccggtattcccgacgctttcgac
ggcgccctgaaacacgtcggcaaccccgacctgatatcccgtacgcattttgcccgctac
atcgtcgaaaccggccgctgcgccgacaccaaggaagtgttccgcaactacctgtgcgaa
ggcaagcctggctacgtaccgcatcgctgggccacgctcagagaatcggtcgaatggatc
tgcggcgccggcggcgtggccgtgattgcgcatccgggccgctattcgtacagcgagctc
gaattcggcgccttgttcgacgagttcaagcaatacggcggcaccggcatcgaagtcatc
accggcagccatacgcccgaccagtacgaggaatatgcgcgcgtggccaggcgtttcggt
tttcttgcgtccatcggctcggatttccacggtccgggagagtcgcacgtcgatctgggc
gccttgccgccgctgccttccgggttgacgccggtgtggcacgactggggcttgtag

DBGET integrated database retrieval system