KEGG   Herbaspirillum hiltneri: F506_11555Help
Entry
F506_11555        CDS       T04039                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
hht  Herbaspirillum hiltneri
Pathway
hht02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hht00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    F506_11555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:hht02022]
    F506_11555
Two-component system [BR:hht02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   F506_11555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AKZ63218
UniProt: A0A0K2BDG5
Position
complement(2533020..2533775)
Genome map
AA seq 251 aa AA seqDB search
MNTTNTSTTATPAHQSKILVVDDDIRLRDLLRRYLTEQGFNVVTAENAQAMNKLWIRERY
DLLVLDLMLPGEDGLAICRRLRGAGDQTPIIMLTAKGEDVDRIIGLEMGADDYLPKPFNP
RELVARINAVLRRKGPDELPGAPSESPESFEFGEFVLDLGTRTLKKKGETVPLTTGEFSV
LKVFARNARQPLSREKLMEMARGREYEVFDRSLDVQISRLRKLIEPDPANPLYIQTVWGL
GYVFIPEGKPR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgaccaacacaagcacaacagccactcccgcccaccaatcgaaaatcctggtg
gtggatgacgacatccgtttgcgcgacctgctgcgccgttacctgaccgagcaaggcttc
aacgtcgtcacggcggaaaacgcccaggccatgaacaagctgtggatccgcgagcgctac
gacctgctcgtgctggacctgatgctgcccggtgaagacggcctcgccatctgccgccgc
ctacgcggcgccggcgaccagacgccgattatcatgctgaccgccaagggcgaagacgtg
gatcgcatcatcggtctcgaaatgggcgccgacgattacctgcccaagccattcaatccc
cgcgaactggtggcgcgcatcaacgcggtcctgcgccgcaagggtccggacgaattgccg
ggcgcgccttcggagtcgcccgagtcgttcgaattcggtgaattcgtcctcgatctcggc
acgcgcaccctgaagaaaaaaggcgagactgtgccgctgaccaccggtgaattctcggtg
ctgaaagtatttgcccgcaatgcgcgccagccgctgtcgcgtgaaaaactcatggaaatg
gcccgcggccgggaatatgaagtcttcgatcgcagcctcgacgtgcagatctcgcgcctg
cgcaaactgatcgaacccgatccggccaacccgctttacatccagaccgtatggggcctt
ggttacgtcttcatccccgagggcaagccgcgctga

DBGET integrated database retrieval system