KEGG   Herbaspirillum hiltneri: F506_17595Help
Entry
F506_17595        CDS       T04039                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hht  Herbaspirillum hiltneri
Pathway
hht00071  Fatty acid degradation
hht00072  Synthesis and degradation of ketone bodies
hht00280  Valine, leucine and isoleucine degradation
hht00310  Lysine degradation
hht00362  Benzoate degradation
hht00380  Tryptophan metabolism
hht00620  Pyruvate metabolism
hht00630  Glyoxylate and dicarboxylate metabolism
hht00640  Propanoate metabolism
hht00650  Butanoate metabolism
hht00900  Terpenoid backbone biosynthesis
hht01100  Metabolic pathways
hht01110  Biosynthesis of secondary metabolites
hht01120  Microbial metabolism in diverse environments
hht01130  Biosynthesis of antibiotics
hht01200  Carbon metabolism
hht01212  Fatty acid metabolism
hht02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    F506_17595
   00630 Glyoxylate and dicarboxylate metabolism
    F506_17595
   00640 Propanoate metabolism
    F506_17595
   00650 Butanoate metabolism
    F506_17595
  09103 Lipid metabolism
   00071 Fatty acid degradation
    F506_17595
   00072 Synthesis and degradation of ketone bodies
    F506_17595
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    F506_17595
   00310 Lysine degradation
    F506_17595
   00380 Tryptophan metabolism
    F506_17595
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    F506_17595
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    F506_17595
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    F506_17595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hht04147]
    F506_17595
Enzymes [BR:hht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     F506_17595
Exosome [BR:hht04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F506_17595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKZ64235
UniProt: A0A0K2BFL9
Position
3853416..3854591
Genome map
AA seq 391 aa AA seqDB search
MNSMDDAVILGWGRSAVTPLGGALSQLQPHEIAAPVVQGILQRFGIPLTAVDAVIAGNAM
GAGGNPARMLALAAGFADCIPALSVDSQCCAGLDAVALAHGMLAAGNADVVIAGGVEAWS
RAPVRLHRPRHAGEAAIAYDSPAFAPDPARDPGMLQAAARHALTAGITREQQDAWAVQSH
ARAVAARAHIRDEIIAIGAATLDSYPRTLEQRHLTRMPVVAMSDDGSVDEASRQRHAVSR
IAISPSADGAAFVVIATRDAARRLNLHPHFAWRAGVSVGGLPETPMLAAIDAAQAALARI
ASKIDDLWGVELHDAFAAQAIAFCDALALSPAQLNRHGGGLGRGHPIGASGAISLVRLLA
DMRHAAPDGAIGLATIAAAGGLGAAAVVERC
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaattccatggacgacgccgtcatcctcggctggggccgcagcgcggtgacgccgctc
ggcggcgcgctgtcgcaactgcaaccgcatgagatcgccgcccccgtcgtgcaaggcatc
ctgcaacgcttcggtattccgttgaccgccgtcgacgccgtgatcgccggcaacgccatg
ggtgcaggcggcaacccggcgcgcatgctggcactggcggccggtttcgccgactgcatt
ccggccttgtcggtcgacagccaatgttgcgccggactcgacgccgtcgccctcgcccac
ggcatgctcgccgccggcaacgccgacgtcgtcatcgcgggcggcgtcgaggcatggagc
cgcgcgccggtccgcctgcatcgtccgcgccatgcgggcgaagcggcgatcgcctacgac
agtcccgccttcgctcccgatccggcgcgcgaccccggcatgttgcaggccgctgcgcgc
catgcattgacggccggcatcacgcgcgagcagcaggatgcatgggcggtccaaagccat
gcacgcgccgttgccgcgcgcgcccatatccgggatgaaatcatcgccatcggcgcggcg
acgctggacagctatccgcgcacgctcgagcagcgtcacctgacgcgcatgccggtggtg
gccatgtccgatgacggcagcgtcgatgaagcgagccggcaacgccatgccgtcagccgc
atcgccatctcgccaagcgccgacggcgccgccttcgtcgtgatcgcgacgcgtgacgcc
gcacgccggttgaacctgcacccgcatttcgcatggcgagccggcgtcagtgtcggcggc
ctgcccgaaacgccgatgctggccgccatcgatgccgcgcaggcggcgctggcgcgcatc
gcgagcaaaatcgatgacctgtggggagtggaattgcacgatgccttcgcggcgcaggca
atcgctttctgcgacgcactggcactctcgccggcgcagctcaatcgccacggcggcgga
ctcggccgcggtcatcccatcggcgcatcgggcgcaatcagcctggtgagattgttggcg
gacatgcggcatgcagcaccggacggcgccatcggcctcgcgacgattgcggcggcaggc
ggcctcggtgctgcagccgtcgtcgagcgttgctga

DBGET integrated database retrieval system