KEGG   Herbaspirillum hiltneri: F506_20305Help
Entry
F506_20305        CDS       T04039                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hht  Herbaspirillum hiltneri
Pathway
hht00051  Fructose and mannose metabolism
hht01100  Metabolic pathways
hht01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    F506_20305
Enzymes [BR:hht01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     F506_20305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AKZ64681
UniProt: A0A0K2BHM9
Position
4484997..4485755
Genome map
AA seq 252 aa AA seqDB search
MELRSKEYFDQRATQEMQQHLGKSNRSLRETLAYAARILAMTGQEAGLAGQISARSERAG
AYWTLRFGLGFDEATPEDFIEVDGDLNTLSGTGMANPATRFHLWVYKARPHCNSIIHTHS
PYVSALAAARQPLVVSQMDMTPFHNDCAFLPDWPGVPIADQEGVIISEAMGRNRSIILAS
HGQLTTGDCVEEATYLAVYLERAARMQVRARVFGPTTPLPDHLAAEAHDYLLKPSIVKGT
FDYWCRQDDASR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcgaagcaaggagtatttcgaccagcgagccacgcaggaaatgcagcagcat
ctcggcaagagcaatcgctcgctgcgcgagacgctcgcttatgcggcccgcatcctggcg
atgacgggacaggaagccggtctggcgggccagatcagcgcccgctccgaacgcgccggc
gcttactggacactgcgtttcggcctcggtttcgacgaagccacgccggaagatttcatc
gaggtcgacggcgacctcaacaccctgtccggcacgggcatggccaatcccgcgacgcgc
ttccatctctgggtgtacaaggcgcggccgcactgcaacagcatcatccacactcactct
ccctacgtctcggcgctggcggcggccaggcagccgctggtggtatcgcagatggacatg
acgccgttccacaacgactgcgccttcctgccggactggccgggcgtgccgatcgccgat
caggaaggcgtgatcatctccgaagcgatgggccgcaaccgctcgatcatcctggccagt
cacggccagctgaccaccggcgactgcgtggaggaagccacctatctggcggtctatctg
gaacgcgcggcacggatgcaggtccgcgcgcgcgtgttcggcccgaccacgccgctgccg
gatcatctcgccgccgaggcgcacgactacctgctgaagccgtcgattgtcaaaggcacc
ttcgattactggtgccgccaggacgacgcttcccgctga

DBGET integrated database retrieval system