KEGG   Halomonas huangheensis: AR456_04485Help
Entry
AR456_04485       CDS       T04119                                 

Definition
(GenBank) D-hexose-6-phosphate mutarotase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
hhu  Halomonas huangheensis
Pathway
hhu00010  Glycolysis / Gluconeogenesis
hhu01100  Metabolic pathways
hhu01110  Biosynthesis of secondary metabolites
hhu01120  Microbial metabolism in diverse environments
hhu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AR456_04485
Enzymes [BR:hhu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AR456_04485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ALM51625
UniProt: W1N3G7
Position
complement(979058..979996)
Genome map
AA seq 312 aa AA seqDB search
MIPASLKALIDATEGQRIVSWAGREIWVANEIWGQLAISLQGAQVLHYLPAPEDARATGE
PATINSGVDDPLVAGGWLWVTPTPQEAPGAIRGGIPLCWPWFASENTADESPDRSGPMHG
PARKANWQLDAVDEHEEGIEVHLSLPERLHSQLHPRAVVQANAQRLHVELITEHVGDTPI
KMTAALHSYLAVDDVFACRVEGLIGARYLDKLKDFAESEQQGELGVRSGVDRIYHSNAEV
TLDDGQRRMRVARQNSDSVVVWNPGDNVHPDTPPLTARRFLCIESANTRLDPVWMVPGAQ
HMLGTTLSLTND
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgattcccgcatcactcaaggcgctgattgacgccaccgaaggacagcgcatcgtcagc
tgggccggacgtgaaatctgggtcgccaatgaaatctgggggcagttggcgatctcattg
cagggcgctcaggtgcttcattatcttcccgcgcccgaagacgcgcgagccacaggcgaa
ccggcgaccatcaacagtggtgttgatgatccactggtcgcgggtggttggctatgggtt
acgcccacgccgcaggaggctccaggtgcgattcgtggcggtatcccactgtgctggccc
tggtttgccagtgagaacactgccgatgagtctcctgaccgctcaggcccgatgcatgga
ccggcgcgcaaggccaactggcagttggatgccgtcgatgagcatgaagaaggtattgag
gttcacctgtcgttgcccgagcggctgcacagtcaactgcatccgcgcgcggtggtccag
gccaatgcgcagcgcctgcatgtcgagctgatcaccgagcatgtcggagatacgccaatc
aagatgaccgcagccctgcatagctatctggcggtggatgatgtcttcgcctgtcgcgta
gaaggtctcatcggcgctcgttatctcgacaaactcaaggactttgccgaaagcgaacag
caaggcgaacttggtgtgcgctccggcgtcgatcgcatctatcacagcaacgcagaggtc
actctcgacgatggccagcgccgcatgcgtgtcgcccgccagaacagtgactcggtggtg
gtatggaatcccggtgacaatgtgcacccggatactccgcctcttaccgccaggcgcttt
ctgtgcatcgagtccgccaacacccgtctcgatccagtgtggatggtgcctggcgcccag
catatgctcggcaccaccctgtcgctgaccaacgactga

DBGET integrated database retrieval system