KEGG   Halomonas huangheensis: AR456_07145Help
Entry
AR456_07145       CDS       T04119                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hhu  Halomonas huangheensis
Pathway
hhu00061  Fatty acid biosynthesis
hhu00071  Fatty acid degradation
hhu01100  Metabolic pathways
hhu01212  Fatty acid metabolism
hhu02024  Quorum sensing
Module
hhu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hhu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AR456_07145
   00071 Fatty acid degradation
    AR456_07145
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AR456_07145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hhu01004]
    AR456_07145
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhu04147]
    AR456_07145
Enzymes [BR:hhu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AR456_07145
Lipid biosynthesis proteins [BR:hhu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AR456_07145
Exosome [BR:hhu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AR456_07145
  Exosomal proteins of breast cancer cells
   AR456_07145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ALM52082
UniProt: W1N4Z4
Position
1590830..1592515
Genome map
AA seq 561 aa AA seqDB search
MNEHDSETIVTGAALEGLDDYHSVMDIFHRSVERYPGNTAFSCMGKLLSYRDLDRLSADF
AAWLQHETDLKPGDRIAIQLPNLLQFPVAVFGAIRAGLVVVNTNPLYTEREMAHQFKDSG
ARAILILANMASKLEKILDQTEIENVLITEIGDLHDFPKRPLINLAVKYIKKMVPRYSLP
KAVSFRQALKKGAGLQHQEVTRQPDDILALQYTGGTTGLAKGTMLTHRNLVANMLQAKAA
IGSGLKSGSEVVVAPLPVYHIYTFTVNCLFMLEGGNHSVLITNPRDLDNFVKELRTTPFT
GFVGLNTLFNALCNRDDFKSLDFSRLHLTISGGMALTRAVAKRWEEVTGCPVAEGYGLTE
TSPIVSFNPVDAIQLGTIGRPVAGTELRLCDAEGKAPPVGEPGELCVRGPQVMKGYWNRD
DETARAIDEDGFFHTGDIAVIQDDGYVRIVDRKKDMILVSGFNVYPNEIEDVVATHPGVV
ESCAVGVPDDTNGEVIKLFVVVKDTSLTAEDLRSWCKKELTAYKVPRVVEFRDELPKTNV
GKVLRRQLRDESTQTEGDSAD
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagcatgacagcgagacaattgtcacgggagccgcgctggaagggttggatgat
taccactcagtgatggatatcttccatcgctcggtggaacgttatcccggcaatactgcc
ttttcgtgcatgggcaagctactcagctaccgtgacctcgaccgcttgtcggctgacttc
gcggcatggctgcagcatgagactgacctcaagccgggggaccgaattgccattcagctg
cccaatctgctgcagttcccggtcgctgtatttggtgcgattcgcgccggcctggtggtg
gtcaataccaatccgctctataccgagcgcgaaatggcgcaccagttcaaggattccggc
gccagggcgattctgattctggccaatatggccagcaagcttgagaagattctcgaccag
accgagatcgaaaacgtactgataaccgagattggtgatctgcatgattttcccaagcgc
ccgctgatcaatcttgcggtcaagtacatcaagaagatggtgccgcgttattctctgccg
aaggcagtgtcattccgtcaggcgctcaagaaaggagcagggctccagcatcaggaggtc
acccgccagccggatgatatcctcgcgttgcagtacaccggcggtaccacaggccttgcg
aagggcaccatgctgacccatcgcaacctggtggcgaatatgctgcaggccaaagccgcc
atcggttccgggctcaagagtggctcagaggtcgtggtggcacctttgccggtctaccat
atctacacctttacggtgaattgtctgttcatgctggagggcggtaatcattcggtgttg
attaccaatccgcgagacctcgacaacttcgtcaaggaattgcgtacgacacccttcacc
gggtttgtgggactcaacacgctgttcaacgcattgtgcaaccgagacgatttcaagtcg
ttggatttctcgcgcctgcatctgaccatctctggtggtatggccttgacccgcgcggtg
gccaaacgctgggaggaggtgaccggctgtccggttgccgagggttacggtctcaccgaa
acatcgccgattgtcagcttcaatccagttgatgccattcagctcggcaccatcgggcgc
ccagtggcgggtaccgagctcaggctgtgtgacgccgaaggcaaggcaccgcccgtaggt
gaacccggagaactctgtgtgcgaggcccgcaggtgatgaagggttactggaatcgtgat
gatgagacagccagagccattgatgaggatggtttcttccacaccggcgatatcgcggtg
attcaggatgatggttatgtgcgcattgtcgaccgcaagaaggacatgattctggtctcc
ggattcaatgtatatccaaatgagatcgaggatgtggtggcgacccatccgggcgtcgtt
gaatcctgtgcggttggggtgccggacgataccaacggtgaagtgatcaagctgtttgtc
gtggtcaaggatacttctctgactgctgaggacctgcgcagctggtgcaagaaggagctg
acggcctacaaggtgcccagggtggtggagttccgcgatgaactgcccaagaccaatgtc
ggcaaggtattgcgccgccaactgcgtgatgagtcgacccagactgagggtgatagcgct
gactga

DBGET integrated database retrieval system