KEGG   Halomonas huangheensis: AR456_07215Help
Entry
AR456_07215       CDS       T04119                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hhu  Halomonas huangheensis
Pathway
hhu00071  Fatty acid degradation
hhu00072  Synthesis and degradation of ketone bodies
hhu00280  Valine, leucine and isoleucine degradation
hhu00310  Lysine degradation
hhu00362  Benzoate degradation
hhu00380  Tryptophan metabolism
hhu00620  Pyruvate metabolism
hhu00630  Glyoxylate and dicarboxylate metabolism
hhu00640  Propanoate metabolism
hhu00650  Butanoate metabolism
hhu00900  Terpenoid backbone biosynthesis
hhu01100  Metabolic pathways
hhu01110  Biosynthesis of secondary metabolites
hhu01120  Microbial metabolism in diverse environments
hhu01130  Biosynthesis of antibiotics
hhu01200  Carbon metabolism
hhu01212  Fatty acid metabolism
hhu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AR456_07215
   00630 Glyoxylate and dicarboxylate metabolism
    AR456_07215
   00640 Propanoate metabolism
    AR456_07215
   00650 Butanoate metabolism
    AR456_07215
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AR456_07215
   00072 Synthesis and degradation of ketone bodies
    AR456_07215
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AR456_07215
   00310 Lysine degradation
    AR456_07215
   00380 Tryptophan metabolism
    AR456_07215
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AR456_07215
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AR456_07215
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AR456_07215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhu04147]
    AR456_07215
Enzymes [BR:hhu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AR456_07215
Exosome [BR:hhu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AR456_07215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALM52094
UniProt: W1N659
Position
complement(1609828..1611012)
Genome map
AA seq 394 aa AA seqDB search
MSQRDIVFLSATRTPMGGMLGSLASLTAPELAATAIRAAVENAGITADNIDEGIMGCVLP
AGIKQGPARQAMRQAGIPDSIGATTINKLCGSGMKAAMFAHDLIRAGSGEVMLAGGMESM
SNAPHILTKARSGYRLGHGELKDHMFYDGLEDAETGKLMGSFAQQVADDRRYSRERMDDF
AIASLERAMQATEAGHLNAEMAPVTISTRQGETIVEHDEQPFQAKLDRIRSLRPAFSRDG
TITAANASSISDGASALILASGEAAQRLGAQPLARMLGHATHSRHPSEFTIAPVGAIDKL
LKQLDWKAEDVDLFEINEAFAVVTLMAMDDLGLPHDKVNVFGGACAQGHPVGSTGSRIIA
TLIHALRLRGGKRGIASLCIGGGEATAVAVELID
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacgcgacattgtctttctatccgccacccgcacccccatgggaggaatgctg
ggttcactcgcctcactgacggcaccagagctggccgccaccgcgattcgcgccgccgtc
gagaacgccggtattaccgcagacaacatcgacgaaggcatcatgggttgtgtattgccc
gccggtatcaagcagggccccgcgcgtcaggccatgcgccaggcaggcattcccgatagc
ataggtgccacgaccatcaacaaactgtgcggctcgggcatgaaggcggccatgttcgca
cacgacctgatcagagccggcagcggcgaggtcatgctggcgggaggcatggagtcgatg
tccaacgctccgcacatcctgaccaaagcacgcagcggctaccgactgggacatggagag
ttgaaggatcacatgttctacgatgggctggaagatgccgaaaccggcaaactgatgggt
agctttgcccagcaggttgccgatgatcggcggtacagtcgcgaacgcatggacgatttc
gccattgcctctctggagcgcgccatgcaggccactgaggccggacatctgaatgccgaa
atggctccggtcacgatcagtactcgtcagggcgagacgattgtcgaacacgacgaacaa
cccttccaggccaaactcgaccgtatccgtagcctacgccccgccttctcgcgtgatggc
accatcaccgcggccaacgccagttccatctccgatggtgcctcggcgctgattctcgcc
tccggcgaggctgctcagcgccttggtgcccagccgttggcccgcatgttgggtcatgcg
acccattcgcgtcatcccagcgaattcaccattgctccggtgggagccatcgacaagctg
ctcaagcaactcgactggaaggcggaagatgtcgatctgttcgagatcaacgaagccttc
gcagtggtcacgctgatggcgatggatgacctcggcctgccccacgacaaggtcaacgtc
ttcggcggcgcctgcgctcagggacatccggtgggttcgaccggctcacgtatcatcgcg
actctgatccacgcactgcgtctacgcggcggcaaacgtggcatcgcaagcctttgcatt
ggtggtggtgaagcgaccgcagtggcggtcgagctgatcgactga

DBGET integrated database retrieval system