KEGG   Halomonas huangheensis: AR456_19595Help
Entry
AR456_19595       CDS       T04119                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
hhu  Halomonas huangheensis
Pathway
hhu00860  Porphyrin and chlorophyll metabolism
hhu01100  Metabolic pathways
hhu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AR456_19595
Enzymes [BR:hhu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     AR456_19595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C MarR_2 AA_kinase
Motif
Other DBs
NCBI-ProteinID: ALM54224
UniProt: W1N5G7
Position
complement(4517934..4519313)
Genome map
AA seq 459 aa AA seqDB search
MSADILPFERCLVEKYDRPGPRYTSYPTAPHFHEAFDTSAYHAAVAASDQPGPLSVYVHV
PFCESLCYYCACSKIITHNRQRATQYLGYLKREIALQAELFDPSRVMTQLHLGGGTPTFL
SPDQLAELLECLNRHFHFAAEHEREFSLEVDPRTVTPEQVFALRNLGFNRLSLGVQDFDP
AVQQAVNRVQSEAEVRALIDAAREAGFASVSMDLIYGLPLQTRDSFARTLEQVIAIRPDR
IAAYSYAHLPHLFKAQRLIRDADMPPPSRKLELLELTIERLTAAGYVYIGMDHFALPEDE
LSLARRDGSLQRNFQGYSTQGECDMIGLGITSIGRVGNAYSQNVKTTSEYMACLDAGRIP
VLRGYCLTAEDRLRADVIAALMCHEGFRFADIEQRHGIDFAEHFADALDQLSEMVDDGLI
EISQVGIRVLPAGRLMLRNIAMAFDGYLASESVRYSRTV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgatattctgccgttcgagcgctgtctggttgaaaagtacgaccgccccgga
ccgcgctacacctcttatcccactgcgcctcatttccatgaggcattcgacacatccgcc
taccacgcggcggtggcggccagcgaccagccaggcccgttgtcggtgtatgtccatgtg
ccgttctgcgagagcctgtgctattactgcgcctgctcgaagatcatcacccacaaccgt
cagcgtgcgacgcagtatctgggatatctcaagcgtgagattgccctgcaggctgagctt
ttcgatccttcccgagtaatgacgcagctgcatctcggcggcggcacgcctaccttcctg
tctcccgatcagcttgccgagttgctggagtgcctgaatcggcattttcacttcgctgcg
gagcatgagcgtgagttctcccttgaggtggacccgcgtacggtgacgccggagcaggtc
ttcgcgttgcggaacctggggttcaatcgcctgagccttggcgtgcaggacttcgatccg
gcggtgcagcaggcggtcaatcgcgtgcagagcgaagccgaggtgagggcgctgatcgat
gctgcgcgggaggctggtttcgcctcggtgtcgatggatctgatctatggcctgccgcta
cagactcgcgacagctttgccagaaccctggaacaggtcatcgccattcgtcctgaccgc
attgccgcgtacagctatgcgcacctgccacatctgttcaaggcgcagcgtctgattcgt
gacgcggacatgccaccgccgtcacgcaaactggagctgctcgagctgaccatcgagcga
ttgacggcagcggggtacgtctacatcggtatggatcacttcgcgctgcccgaggatgag
ctcagcctcgcgcgacgcgatggctcgttgcagcgcaatttccagggctattcgactcag
ggcgagtgcgacatgatcggtctcggcatcacttccatcggccgtgtcggcaatgcctac
agccagaacgtcaagacgacgagtgagtacatggcgtgtctcgacgccgggcggatcccg
gtcctgcgcggctattgtctgactgccgaggaccgtttgcgtgcagacgtcatcgctgcg
ctgatgtgccatgaagggtttcgcttcgctgacatcgagcagcgtcatggtatcgacttc
gccgagcacttcgccgacgcgctggatcagttgagcgagatggtcgatgacggtctgatc
gagatcagccaagtgggtatccgagttctgcccgctggacggctgatgctgcgcaatatc
gccatggccttcgatggttacctggcctccgagagtgtgcggtactcgagaaccgtgtga

DBGET integrated database retrieval system