KEGG   Haliscomenobacter hydrossis: Halhy_0235Help
Entry
Halhy_0235        CDS       T01491                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00670  One carbon pool by folate
hhy01100  Metabolic pathways
hhy01120  Microbial metabolism in diverse environments
hhy01200  Carbon metabolism
Module
hhy_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:hhy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Halhy_0235
Enzymes [BR:hhy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Halhy_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS AAA_31 CbiA ParA AAA_26 ArsA_ATPase
Motif
Other DBs
NCBI-ProteinID: AEE48148
UniProt: F4KUX2
Position
complement(291036..292703)
Genome map
AA seq 555 aa AA seqDB search
MKTDIEIAQGIALQPIANIAAALGIPAPALIPYGHYKAKVQYTEIDEAKVAQSKLILVTA
ITPTKAGIGKTTVGVALAQGLQQLGKKAIVALREPSLGPCFGMKGGACGGGYAQVVPMED
INLHFTGDFHAITSANNMIAALLDNYQYQHRGTELALKQITWRRVLDVNDRSLRFIVSGL
NGPGNGIPQETGFDITPASEIMAIFCLASSLDDLRRRIDNILLGYTHHNQPFTVADLGVG
GAITVLLKDALNPNLVQTLEAGPAFIHGGPFANIAHGCNSIMATKMAMTYGDYVITEAGF
GADLGAEKFLNIKCRQAGIYPKASVLVATSQALKLHGNVTLADIKKPNLKGLQAGLKNLE
RHLENLQHFGQSVVVTFNQYSFDTAEEMDYTAQWCREKGADFALNNGFAEGGRGALPLAE
KVVEVIEKRPSQPIRHTYALEDSIPEKIHKVVTQIYRGKEVVFSKTAETALKKIETLGLA
HLPVCIAKTQYSFSDDAAHIGVASDFTLNIENVIINRGAGFIVAVAGEIMRMPGLPKDPQ
ALHIDVVDGKVVGLS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagacatcgagatcgcccagggaattgcccttcaacccattgccaatattgca
gccgccctcggtattcccgccccagcgctcatcccttacggccattacaaggccaaagtt
cagtacaccgaaatagatgaagccaaagttgcccaaagcaagctgattttggtgaccgcc
atcacccccaccaaggcggggattggcaaaacgacggtaggggtggccctggctcagggt
ttgcaacagttgggcaaaaaagccattgtcgccctgcgcgaaccctctttaggcccctgt
ttcggcatgaaaggaggtgcttgtgggggcggttatgcccaagttgtgcccatggaggac
atcaacctgcattttaccggtgattttcacgccatcacttcggccaataacatgattgcg
gcgctgctggacaactaccagtaccagcaccgtggaaccgaattggccctcaaacaaatt
acctggcggcgcgtactcgacgtcaacgaccgctctttgcgttttatcgtgtcgggactg
aacggccccggcaatggcattccgcaggaaacgggttttgacattaccccggcttctgag
atcatggcgattttttgtttggccagcagtttggacgatctgcgccgccgcatcgacaac
atcctgctgggctacacccaccacaatcaaccttttaccgtagctgatctgggcgttggt
ggagcgattaccgtactgctgaaggacgcacttaaccctaatctggtacaaaccctcgaa
gctggcccggccttcatccacggtggaccctttgccaatattgcccatggttgcaattcc
atcatggccaccaaaatggccatgacttacggcgattacgtgatcaccgaagcgggtttt
ggtgcggatctgggcgccgagaagtttttgaacatcaaatgccgacaagcgggaatttat
cccaaagcatccgttctggtagcaacttcccaggctttaaagttacacggaaacgtgacc
cttgcggacatcaaaaaacccaatctaaagggtttgcaagccggcttgaaaaacctggag
cgccacctcgaaaacctgcaacattttggccaaagtgtggtggtgaccttcaaccaatac
agttttgataccgccgaagaaatggactatactgcgcaatggtgtcgagaaaaaggagct
gattttgccctgaacaacggctttgccgagggtgggagaggagcgctcccgctggcggaa
aaagtagttgaagtgattgaaaaacggccttcgcagcccattcggcatacctacgcattg
gaagattcgatccccgaaaaaatccataaggtggttacccaaatttaccggggcaaggaa
gtggtgttcagtaaaacggccgaaaccgcgctgaaaaagatcgaaaccctcggtcttgcc
cacttgccggtttgtatcgccaaaacccagtattctttcagcgatgacgctgctcatatt
ggtgtagcatcagattttaccctcaacattgaaaacgtgatcatcaatcgtggagccggc
ttcatcgtcgccgtcgcgggggaaatcatgcgcatgccagggctccccaaggacccgcag
gctttgcacattgatgtggtggatgggaaagtggtggggttgagttga

DBGET integrated database retrieval system