KEGG   Haliscomenobacter hydrossis: Halhy_0775Help
Entry
Halhy_0775        CDS       T01491                                 

Definition
(GenBank) Butyrate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00010  Glycolysis / Gluconeogenesis
hhy00620  Pyruvate metabolism
hhy00640  Propanoate metabolism
hhy00680  Methane metabolism
hhy01100  Metabolic pathways
hhy01110  Biosynthesis of secondary metabolites
hhy01120  Microbial metabolism in diverse environments
hhy01130  Biosynthesis of antibiotics
hhy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halhy_0775
   00620 Pyruvate metabolism
    Halhy_0775
   00640 Propanoate metabolism
    Halhy_0775
  Energy metabolism
   00680 Methane metabolism
    Halhy_0775
Enzymes [BR:hhy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Halhy_0775
Lipid biosynthesis proteins [BR:hhy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Halhy_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEE48682
UniProt: F4L3S8
Position
976848..978545
Genome map
AA seq 565 aa AA seqDB search
MDIKDFFSKVREDVSKEQFDNLAGLTVHKPEYFNWVMDIFYDLNVKKHPGSTALIWRHYT
KEKRYTFERIYGAANQFLNFLRKHGIQKGNCIYTQLPLDPANWISTLAAIKGGLVLIPAA
INLIEKDIAYRFKTIFPEVVITDLANAEKIEVAEKILGKTVKVKILVDGERPGWHWIETI
QDEDQTAEAAKTLADDHLFYFFTSGTTGLPKIVTHTHFTYPFGHLSTASWIGMRHGDIHY
NISAPGWAKFAWSSFFAPWNMGATIFANQVDKFEAKEQLKTIEQYGVTTFCAPPTVLRMV
ILEDLSSYHFKFRQCVAAGEPLNAEIIEKWQQGTGIVIRDGYGQTETTCLVANLPGAKIK
YGSMGKPTFLYKVIIANDEGVEQPTFEEGNICIKMDDQKANGVFIDYLGEPERKALVFKH
GLYYTGDKAYQDEEGYIWFVGRDDDVIKASDFRIGPFEVESVLIEHESVVETAVVASPHP
LRGFAVKAFVLLRAGEMGSQELAEELFAHCENNLAAYKIPRIIEFVEALPKTISGKIRRV
ELRAGEAERKSRQEVSAAEFFHKKY
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggacatcaaggattttttcagcaaggtgagggaagacgtttcgaaggagcaattcgac
aatttggcgggtttgactgtacacaaacccgaatatttcaactgggtgatggatattttt
tacgacctgaatgtaaaaaaacatcccggcagcacggccttgatctggcgacactatacc
aaagagaagcggtacacctttgagcgcatctacggagcagccaaccagtttctgaatttc
ctgcgcaaacacggcatccaaaagggcaactgcatctatacccaactgcccctcgacccg
gccaactggatcagtaccctggcggccatcaaaggaggactggtgctcattccggcggcc
atcaatttgattgaaaaggacatcgcctatcgtttcaaaaccatttttcccgaagttgtc
atcacggatttggccaacgcggaaaaaatagaagtcgcggaaaaaatcctgggcaaaacc
gtcaaagtgaagatcctcgtggatggtgaacgacccggctggcactggatcgaaaccata
caggatgaagaccaaaccgctgaagcagccaaaaccctggcggatgatcatcttttttat
tttttcacctcgggtaccacgggtttgcccaaaattgtcacgcatacccacttcacatat
ccctttggccatttgtctaccgcttcctggatcgggatgcggcatggcgatatccactac
aacatctccgcgcccggctgggcaaaatttgcctggagcagcttttttgccccctggaac
atgggggcgaccatttttgccaatcaggtggataaatttgaagcaaaagagcaattaaaa
accatcgagcaatacggcgtcaccactttctgcgccccgccaacggtgctccgcatggtg
attctggaagatttatccagctaccatttcaagttcaggcaatgtgtagccgccggtgaa
cctcttaatgccgaaatcattgaaaaatggcaacaaggcacgggcatcgtgatccgggac
ggatatggccaaaccgaaacaacttgcctggtggccaatcttcccggcgcaaaaatcaaa
tacggctccatggggaaacccacttttttgtacaaggtcatcattgccaatgacgaaggc
gttgagcagccgacttttgaagaaggcaacatttgtatcaaaatggatgaccaaaaagcc
aatggtgtcttcatcgattacctgggggaacctgaacgcaaagcactggtttttaagcac
ggtttgtactacactggcgacaaagcttaccaggatgaagaaggctacatctggtttgtg
ggccgggatgatgacgtgatcaaagcctccgatttcaggattggcccttttgaagtggaa
agtgtattgattgaacacgagtcggtagtagaaactgcggtggtggcgagcccacatcca
ctgaggggttttgcagtgaaggcctttgtgctgttaagggcgggagaaatgggcagtcag
gaactggccgaggaattgtttgcccattgtgaaaacaacctggctgcttacaaaatcccc
cggatcatcgagtttgtggaagcactccccaaaaccatcagtgggaaaatccgccgggtt
gaattgagggccggtgaagccgagcgcaaaagcagacaagaggtaagcgcagctgaattt
tttcacaagaaatactag

DBGET integrated database retrieval system