KEGG   Haliscomenobacter hydrossis: Halhy_2454Help
Entry
Halhy_2454        CDS       T01491                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hhy  Haliscomenobacter hydrossis
Brite
KEGG Orthology (KO) [BR:hhy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Halhy_2454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Metal_resist
Motif
Other DBs
NCBI-ProteinID: AEE50328
UniProt: F4KXF7
Position
complement(3157612..3158994)
Genome map
AA seq 460 aa AA seqDB search
MNAFDLSALSSGGAVMLILFLIAVLAFEFVNGFHDTANAVATVIYTHSLRPTVAVVWSGI
WNFLGVITGGVGVAMGIVKLLPVNDMMIMPFFESASIIAAVLLAAIIWNLGTWYYGIPSS
SSHTMIGALLGVGIGFYWIHGGDGVNWGKAQEIALALLFSPFFGCFAALFLMWFLSKIIK
NKEIFHEPERGKAPPTWIRAILITTCTLVSFFHGSNDGQKGVGLFMIVLMIFLPAQFALH
KSFDAEAILTVVNKIEQKTSTAMDNSPRRNEAAQEVMEAAGELRVLLAQTTPDRPAVRKE
LQKLNKNLKEATNVRSFYNPKDKAEFKMVADQLATTYEYAPRWVIFFISLALGIGTMIGW
KRIVVTIGEKIGKTHLTYAQGATAELVASATIAMSTVFHAPVSTTHVLSSAVAGTMIAKN
GRKNLQKSTLITILSAWILTLPVTIIMSCGLYLLFRTIFG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttttgacctctctgccttaagctccggaggagcagtgatgctgatccttttt
ttgattgccgtattggcttttgaattcgtcaatggctttcacgatacggccaatgccgta
gctacggtgatttatactcattcgcttaggccaactgttgcggttgtttggtcaggtatt
tggaactttcttggtgtaattaccggtggagtaggcgtagcaatggggattgttaagttg
cttccagtcaacgatatgatgatcatgcctttttttgaaagcgcgagcatcatcgcagcg
gtactattggcggccatcatttggaacctgggtacctggtattacggcatcccttcttcc
agttcgcataccatgattggtgcgttgctgggggtaggcattgggttttattggatacac
ggtggcgatggggtcaactggggtaaggcgcaagaaattgccctggccctgttgttttcg
cccttctttggctgcttcgcggcgctttttttgatgtggtttttatcaaaaataatcaag
aacaaagagatttttcatgaaccagagcgaggtaaagcaccccccacctggattcgggcg
atactaattacgacttgtaccctggtgagttttttccatggatccaacgatggacagaaa
ggggtgggtttgtttatgattgtgctgatgattttccttcctgctcaatttgccctgcac
aaaagttttgatgcagaagccatcttgacggttgtcaataaaatagagcaaaagaccagt
acggcaatggacaattcgccccgcagaaatgaagctgcacaggaagtcatggaagctgcg
ggtgagctgcgggtattattggcgcaaacgactcccgatcgccctgcggtgcgcaaagag
ttgcaaaaactgaacaaaaacctcaaagaagcaaccaatgtcagatccttttataaccca
aaggataaagctgaattcaaaatggtggccgatcagttggcgactacttacgaatatgcg
ccacgctgggttattttcttcatttccctggcactgggcattggtaccatgattggttgg
aaacggattgtagtgaccatcggggagaaaattggtaagacgcacctgacttacgctcag
ggcgctacggcagaattggtggcctcggcaaccattgcgatgagtaccgtttttcatgct
ccggtaagtacaacccacgtgctttcatcggcagtagcgggcaccatgattgctaaaaat
ggccgcaaaaacctccaaaaatctaccttaatcacgatcctctctgcgtggatcctcacc
ttgcccgtgaccatcattatgtcgtgtggcttgtacttgttgttcaggacaatctttggt
tga

DBGET integrated database retrieval system