KEGG   Haliscomenobacter hydrossis: Halhy_2810Help
Entry
Halhy_2810        CDS       T01491                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00010  Glycolysis / Gluconeogenesis
hhy00030  Pentose phosphate pathway
hhy00051  Fructose and mannose metabolism
hhy00052  Galactose metabolism
hhy00680  Methane metabolism
hhy01100  Metabolic pathways
hhy01110  Biosynthesis of secondary metabolites
hhy01120  Microbial metabolism in diverse environments
hhy01130  Biosynthesis of antibiotics
hhy01200  Carbon metabolism
hhy01230  Biosynthesis of amino acids
hhy03018  RNA degradation
Module
hhy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halhy_2810
   00030 Pentose phosphate pathway
    Halhy_2810
   00051 Fructose and mannose metabolism
    Halhy_2810
   00052 Galactose metabolism
    Halhy_2810
  Energy metabolism
   00680 Methane metabolism
    Halhy_2810
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Halhy_2810
Enzymes [BR:hhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Halhy_2810
Protein phosphatases and associated proteins [BR:hhy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Halhy_2810
Messenger RNA biogenesis [BR:hhy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Halhy_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase Alba
Motif
Other DBs
NCBI-ProteinID: AEE50676
UniProt: F4L317
Position
3579342..3580313
Genome map
AA seq 323 aa AA seqDB search
MKKIGVFTSGGDSPGMNACIRAVVRTALHEGLAVAGIRRGYQGFIDGDIYDMDHHSVSNI
IQQGGTILRSARCSEFHSPEGRQQAYENLAKFGIDGIVAIGGDGTFTGASIFMQEHPEIK
FVGCPGTIDNDLLGTDYTIGYDTAINTAMEAIDKIRDTASAHDRLFFIEVMGRDAGFIAM
AAGIATGAEAILIPETHTDIEGLIKKLEWGWENKKNSSIVVVAEGDEAGGAHKIAEMVKA
RLSRYEIKVSILGHIQRGGRPSCMERVRASRMGVAATQALIAGKSNVMIGIVNNQIVYTP
FHQCIKEHQQMDSALVEMVDVLS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattggtgtattcacctctggcggagactctccgggcatgaatgcctgcatc
cgggcagtagtacgtactgcattacacgaaggacttgctgtagctggaattcgccgtggt
tatcaggggtttattgatggcgacatctacgatatggatcaccattcggtgagcaacatc
attcaacaggggggcacgattttgcgttctgcccgctgttccgaatttcatagcccggaa
ggacggcagcaagcctacgaaaatctggccaaatttggcatcgatgggatagtcgccatt
ggcggggatggtaccttcacaggagccagtattttcatgcaagaacatcccgaaatcaag
tttgtcggctgtcctggtaccatcgacaacgatcttttgggcacagattacaccattggt
tatgataccgccatcaatacggctatggaagccattgataaaatacgggatacggccagc
gcccacgatcgtttgttttttattgaagtaatgggccgggatgccggatttattgccatg
gcggcaggcatcgccacaggcgcagaagcgatcctgattcccgaaacccataccgatatt
gaaggattgatcaaaaaactggaatggggctgggaaaacaaaaaaaactccagcatagtc
gtggtagcggaaggagacgaggccggtggtgcacacaaaattgctgaaatggtcaaggcc
agactgagccgttatgaaatcaaagtttccattttgggacacatccagcgcggtggtcgt
ccctcctgtatggaacgggtacgcgccagccggatgggtgtagccgctactcaagccttg
attgccggtaaatccaatgtcatgatcggcattgtcaacaatcaaattgtctacacgcct
tttcaccagtgcatcaaagagcaccaacaaatggacagtgctttggtcgaaatggttgac
gtactcagttga

DBGET integrated database retrieval system