KEGG   Haliscomenobacter hydrossis: Halhy_2938Help
Entry
Halhy_2938        CDS       T01491                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00260  Glycine, serine and threonine metabolism
hhy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hhy01100  Metabolic pathways
hhy01110  Biosynthesis of secondary metabolites
hhy01130  Biosynthesis of antibiotics
hhy01230  Biosynthesis of amino acids
Module
hhy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halhy_2938
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halhy_2938
Enzymes [BR:hhy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Halhy_2938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEE50802
UniProt: F4L5D8
Position
3726464..3727825
Genome map
AA seq 453 aa AA seqDB search
MQNRKTLLTEQEIPDKWYNIVADMPNKPLPPLHPGTREPIGPEALAPLFPMELIKQEVST
DKWIPIPDAVRDIYTMWRPTPLYRAYALEKALDTPAKIYYKYEGVSPAGSHKPNTAVPQA
YYNKMEGVKRITTETGAGQWGSALSFACQHFGIECEVYMVKVSYDGKPYRKMMMNTWGAK
VYSSPTDHTQSGRQILAQDPNSPGSLGIAISEAVERAATDENTKYALGSVLNHVLMHQTI
IGLEAVEQMKKVGDMPDVVVAPFGGGSNFAGISFPFLRLNFDEGRNIRFVASEPASCPKL
TRGVFRYDFGDTVGMTPLLPMYTLGHNFVPAPIHAGGLRYHGAGVIVSQLLKDQLIEARA
HHQLECFEAGVLFAKTEGIIPAPEASHALATVFAEAQAAKEEGKSRTILFNLCGHGHFDL
QAYDDYFNNRLVKHEVTNEDIANSLATLDTPVI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcgcaaaactttattgaccgaacaggaaattccagacaagtggtacaatatc
gtggccgacatgcccaataaaccattgccacctttacatcctggcacccgggagccgatt
ggcccggaagcattggcccctctatttcccatggaactcatcaaacaggaagtaagtacc
gacaaatggatacccattccggatgcagtacgtgatatttacacgatgtggcggcctacg
ccgctttaccgtgcctacgccctggaaaaagcgctggatactccggcaaaaatctactac
aaatacgaaggcgtaagcccggctggttcacacaaaccgaatactgccgttccccaggcc
tattacaacaaaatggaaggggtgaaacgcatcactaccgaaaccggggccggacaatgg
ggcagcgccttgtcctttgcctgccaacatttcggcatcgagtgtgaggtgtacatggtt
aaggtcagctacgatggcaaaccctaccgcaaaatgatgatgaatacttggggggctaag
gtttactcttcacctaccgatcatacccaatctggacggcaaattttggctcaggatccc
aactctcccggtagtttgggaatcgccatctccgaagcggtagaacgcgccgccacggac
gaaaataccaagtacgccctcggcagtgtgctcaatcacgtactgatgcaccaaaccatc
atcggcttagaggccgtggaacaaatgaaaaaagtgggcgacatgcccgatgtggtggtg
gcaccttttgggggaggatccaattttgcgggtatttctttcccttttttgcgcctcaat
tttgatgaaggccgcaacatccgttttgtggccagcgaacccgcgtcttgtccaaaactg
acgcgtggggttttccgctatgatttcggcgacacggtggggatgacgccactgctgcca
atgtatacactggggcacaacttcgtaccagcgcccattcacgcgggtggcttgcgctac
cacggtgccggggtcatcgtgagccagttgctcaaagaccaattgatcgaagcgcgggcg
catcaccagctggagtgctttgaagcaggtgtgctttttgccaaaaccgaaggcatcatc
ccggctccggaagcaagtcatgcactagccaccgtatttgcggaggcgcaagcagccaaa
gaagaaggcaaatcgcgcacgatcttgttcaacctctgcggtcatgggcattttgacttg
caagcatatgatgattatttcaacaatcgcctggtgaagcacgaggtgacgaatgaggat
atcgcgaattcgttggcgactttggatacgccggtgatttag

DBGET integrated database retrieval system