KEGG   Haliscomenobacter hydrossis: Halhy_3410Help
Entry
Halhy_3410        CDS       T01491                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00310  Lysine degradation
hhy01100  Metabolic pathways
hhy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Halhy_3410
Enzymes [BR:hhy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     Halhy_3410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Amino_oxidase Pyr_redox_2 Lycopene_cycl Pyr_redox_3 Thi4 FAD_binding_2 Mqo Trp_halogenase Pyr_redox NAD_binding_9 NAD_binding_7 HI0933_like AlaDh_PNT_C GYD FAD_binding_3 GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: AEE51266
UniProt: F4KVF3
Position
complement(4305036..4306235)
Genome map
AA seq 399 aa AA seqDB search
MKKEVLIIGGGIVGLATAWRLMEARPDLKVTVLEKEPELATHQTGHNSGVIHSGIYYRPG
TLRARNCMEGYGELLRFCDEHAIPYDICGKIIVATRPEELPHLDKILDHGLQNGLKDIRR
ISAAETREHEPHVNVVESLWVPQAGIINYRKVANKYAELITARGGVIRTGFKVTSIKRSD
NEITVIGEAGEVSGDLLISCAGLYADKVAKMTGQKIPGIQILPFRGEYYELKPEKQYLVN
NLIYPVPNPEFPFLGVHYTRMIEGGIEAGPNAVLAFRREGYSRWDLDLPELLETLSYPGF
MRLAAKHWRYGWGEMYRSFSKSAFVKALQHLIPEVGYDDLQRGGAGVRAMACDLEGKLID
EFLIFEDHNIINVCSAPSPAATASLAIGKTIAGKALERV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaggtactcatcattggaggaggaattgtcggtttggctaccgcgtggcgc
ttgatggaagcaaggcccgacttgaaggtgaccgtgctggaaaaggaaccagagttagca
acccaccaaacgggccacaacagtggggtgatccattcgggaatctactatcgtcccggt
actttgcgcgcccggaactgcatggaagggtatggagagctgttgcgtttttgtgatgag
catgccattccttatgacatctgtggcaaaataattgtggctacccgccccgaagaattg
ccccacttggataaaatcctcgatcatggcctgcaaaatggcttaaaggacattcggcgc
atcagtgctgccgaaacccgcgaacacgaaccccacgtcaatgtcgtcgaatcgctttgg
gttcctcaagcgggcatcatcaactaccgcaaggtggctaacaaatacgccgaattgatt
accgctcgtggaggggtgatccgtacgggctttaaagtgacttccatcaaacgcagcgat
aacgagattacggttatcggtgaagcgggcgaagtatccggggacttgctgatcagttgt
gcgggtttgtatgccgataaggtcgctaaaatgaccgggcaaaaaatcccgggcatccaa
attttacctttccggggagagtattacgagctcaaacctgaaaagcaatatttggtcaat
aacctgatttatcccgttccaaatcctgaatttcccttcttgggcgttcattatacccgg
atgattgaggggggaattgaagctggccccaatgcggtgctggcattccgccgcgagggc
tacagccgctgggatctggaccttcctgagttgctagagaccttgtcttatcccggtttt
atgcgtctggcggccaaacactggcgctacggctggggcgaaatgtatcgctctttttcc
aaaagcgcctttgtcaaagccttgcaacacctgatccctgaggttgggtacgacgacctt
cagcgcggcggtgccggagtgcgggccatggcctgtgacctcgaaggcaaattgattgac
gaattcctcatttttgaggaccacaatattattaatgtatgcagcgctccttctccggct
gccaccgcctctttggcgattggtaagacgattgcggggaaagcgctggaaagggtttga

DBGET integrated database retrieval system