KEGG   Haliscomenobacter hydrossis: Halhy_4779Help
Entry
Halhy_4779        CDS       T01491                                 

Definition
(GenBank) succinyl-CoA synthetase, alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00020  Citrate cycle (TCA cycle)
hhy00640  Propanoate metabolism
hhy00660  C5-Branched dibasic acid metabolism
hhy01100  Metabolic pathways
hhy01110  Biosynthesis of secondary metabolites
hhy01120  Microbial metabolism in diverse environments
hhy01130  Biosynthesis of antibiotics
hhy01200  Carbon metabolism
Module
hhy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hhy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Halhy_4779
   00640 Propanoate metabolism
    Halhy_4779
   00660 C5-Branched dibasic acid metabolism
    Halhy_4779
Enzymes [BR:hhy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Halhy_4779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AEE52613
UniProt: F4KXV4
Position
6037322..6038194
Genome map
AA seq 290 aa AA seqDB search
MAVLVNKDSRIIVQGFTGKEGTFHATQMLEYKTNLIGGVTPGKGGTTHLDKPVWDTVEQA
VKLGGADVSVIFVPPAFAADAIMEAADAGIKVIICITEGIPVQDMVKVKAYIATRDCRLI
GPNCPGVITPDEAKCGIMPGFIHKKGTIGIVSRSGTLTYEAVDQVTKAGLGQSTCIGIGG
DPIVGTSTKEAVELLMNDPETEAIIMIGEIGGGMEAEAARYVQAFGTKPVVGFIAGQTAP
KGRKMGHAGAIIGGDDDTAEAKMKILEECGIHVVKSPADLGTTVLKALGR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcggttctcgttaataaggattcccggatcattgtacagggattcaccggcaaggaa
ggtacgttccatgccacccaaatgttggaatacaagacaaatttgattggtggggttact
cccggcaaaggaggaaccacccatttggacaagccagtttgggataccgttgagcaagcc
gtgaaattgggcggtgctgacgtatccgtcatctttgtaccccctgcttttgctgccgat
gccattatggaagcagccgacgcgggcatcaaagtcatcatctgcatcaccgaaggtatt
ccggtacaagacatggtgaaagtgaaagcctatatcgccacccgcgattgccgcttgatc
ggccccaactgccccggtgtcatcacgcccgatgaagccaaatgtggcatcatgcccggg
ttcatccacaaaaaagggaccattggcatcgtttcccgctccggtacattgacctatgaa
gccgtagatcaggtgaccaaagctggcctgggacaatcgacctgtatcggtattggtgga
gaccccatcgtgggcacttccaccaaagaagcggttgaactgctgatgaacgaccccgaa
accgaagccatcatcatgattggtgaaattggtggaggcatggaagctgaagcagcacgt
tacgtacaagcttttggtaccaagccggttgtaggatttatcgcaggccagacggcgcct
aaaggccgtaaaatggggcacgcgggtgccatcattggtggcgacgatgacactgctgag
gccaagatgaaaatcctggaagagtgtggcattcacgtcgtgaaatctccagctgacttg
ggaactaccgtgttgaaagcactgggaagataa

DBGET integrated database retrieval system